KEGG   Lactobacillus plantarum ZJ316: zj316_0164Help
Entry
zj316_0164        CDS       T02458                                 

Definition
(GenBank) putative phosphoketolase 2
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
lpt  Lactobacillus plantarum ZJ316
Pathway
lpt00030  Pentose phosphate pathway
lpt01100  Metabolic pathways
lpt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lpt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    zj316_0164
Enzymes [BR:lpt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     zj316_0164
    4.1.2.22  fructose-6-phosphate phosphoketolase
     zj316_0164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP_C XFP
Motif
Other DBs
NCBI-ProteinID: AGE37703
UniProt: M4KDH0
Position
178830..181220
Genome map
AA seq 796 aa AA seqDB search
MSEAIKSKTVDYSSDDYLKRVDAYWRAANYISVGQLYLLNNPLLREPLKATDVKVHPIGH
WGTIAGQNFIYAHLNRAINKYGLNMFYIEGPGHGGQVMVSNSYLDGTYTETYPKITQDKA
GMKRLFKQFSFPGGVASHADPKTPGSIHEGGELGYSILHGAGAVLDNPGLIAATVVGDGE
SETGPLATSWQVNKFLNPITDGTVLPILNLNGFKISNPTVLSRESHEELEDYFKGLGWDP
HFVEGTDPAKMHKIMAEELDKVIEEIHAIRKNAKDNNDESRPKWPMIVFRAPKGWTGPKS
WDGEPIEGSFRAHQIPIPVDRNHMEHADKLVDWLKSYKPEELFDENGTLKPEIAAIIPEG
QARMAANPVTNGGKLTKDLITPNIDDYALDNKDHGKEDGSDMTELGKYIRDLIELNKDNK
NFRGWGPDETLSNKLGAAFEDTKRQWMEPIHEPNDALLAPQGRIIDSMLSEHMDEGMLEA
YNLTGRYGFFASYESFLRVVDSMLTQHFKWLRNSHEETPWRVDVPSLNVIASSTAFQQDH
NGYSHQDPGIISHLAEKKTEYVRAYLPGDANTLIATFDKAIQSKQLINLIIASKHPRPQW
FTMDEAKHLVRDGLGVVDWASTDNGEEPDVVFATAGSEPTTESLAAVSILHARFPEMKIR
FINVVDLLKLKKDDPRGLSDAEFDAFFTKDKPVIFAYHAYDDLVKTIFFDRHNHNLHVHG
YREEGDITTPFDMRVRNELDRFHLVKAALLATPAYAEKGAHVIQEMNSILNKHHDYIRAE
GTDLPEVENWKWTALK
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagcaattaaatccaaaacagttgattattcttctgatgactatctaaaacgc
gtcgatgcctattggcgcgctgctaactacatctcagttggtcaactctatctattaaat
aatccgttacttcgggaaccattaaaggcgaccgatgtaaaagtccatccaatcggtcat
tggggcacaattgccggccaaaactttatttatgcccatttgaaccgtgctattaacaag
tatgggctcaacatgttctacatcgaaggtcctggtcatggtggccaagtaatggtttct
aactcctacttagatggtacttatacggaaacgtatcctaaaatcacccaagacaaggcc
ggaatgaagcgcttattcaagcaattctcattcccaggtggtgttgcctcccacgccgac
cctaagacaccaggctcaatccacgaaggtggcgaacttggctactcaatcttgcatggt
gctggtgcggtcttagataaccctggtttaattgctgctactgttgttggtgatggtgaa
tctgaaactggcccattggcaacttcttggcaagttaacaagttcctcaacccaattaca
gacgggacagtcttaccaatcttgaacttaaacggcttcaagatttctaacccaacagtt
ctttcacgtgaatcacatgaagaacttgaagactactttaaaggtctaggctgggatcca
cactttgttgaaggtacagaccctgccaagatgcacaaaatcatggctgaagaattggat
aaagtcattgaagaaatccacgcaattcgtaagaacgccaaggataacaatgatgaatct
cgtcctaagtggccaatgattgttttccgggcacctaagggctggaccggtcctaagagt
tgggacggcgaaccaattgaaggttcattccgggctcaccaaattccaattcctgtcgat
cgcaatcacatggaacacgccgacaaattagttgactggctcaaatcatacaaaccagaa
gaattatttgatgaaaatggtactttaaaaccagaaattgccgcaatcatccctgaaggc
caagctcgtatggctgctaatcccgtcactaacggtggcaagttaactaaagacttaatt
acaccaaatatcgatgattatgctttggacaacaaggatcacggtaaggaagacggttca
gacatgactgaacttggtaagtatatccgtgatttaatcgaattaaacaaagataacaag
aacttccgcggttggggtcctgatgaaactttatctaacaaattaggagctgcgtttgaa
gataccaagcgtcaatggatggaaccaatccacgaacctaacgatgctttgttagcacct
caaggccggattattgactccatgttgtcagaacatatggatgaaggcatgttggaagct
tacaacttaactggtcgttacggcttctttgcaagttatgaatcattcctacgcgttgtg
gattcaatgttaacccaacatttcaagtggttacggaattctcacgaagaaacaccttgg
cgggttgatgtcccttcattaaacgtgattgcatcatcaactgccttccagcaagatcac
aatggttactctcaccaagatccaggtatcatctcacacttggctgaaaagaagaccgaa
tatgttcgggcctatctcccaggtgacgctaacaccttgattgcaacttttgataaggcg
atccaaagtaaacaattgattaacttgatcatcgccagcaagcatccccgtccacaatgg
tttacgatggacgaagctaagcatttagttcgtgatggcttaggtgtggttgattgggca
agtactgataatggtgaagaacccgacgttgtcttcgcaactgccggctctgaaccaacg
actgaaagtttagcggccgtatcaatcttgcacgctcgcttccctgaaatgaagattcgc
ttcattaacgttgtcgatcttctgaagttgaagaaggacgacccacggggcttatcagat
gctgaatttgatgccttcttcactaaagacaagccagttatctttgcataccatgcttac
gatgacttagtaaagaccatcttcttcgaccgtcataaccataacttacacgttcatggc
taccgcgaagaaggcgacattaccacgccattcgacatgcgtgttcgcaacgaactcgat
cgtttccacttagttaaagctgccttattagcaacgccagcctatgccgaaaaaggtgcc
catgtcatccaagagatgaacagcatcttaaacaagcatcatgactatatccgtgctgaa
ggtactgatcttccagaagttgaaaactggaaatggactgcattgaagtag

DBGET integrated database retrieval system