KEGG   Lactobacillus plantarum ZJ316: zj316_0415Help
Entry
zj316_0415        CDS       T02458                                 

Gene name
ack1
Definition
(GenBank) Acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
lpt  Lactobacillus plantarum ZJ316
Pathway
lpt00430  Taurine and hypotaurine metabolism
lpt00620  Pyruvate metabolism
lpt00640  Propanoate metabolism
lpt00680  Methane metabolism
lpt01100  Metabolic pathways
lpt01120  Microbial metabolism in diverse environments
lpt01200  Carbon metabolism
Module
lpt_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:lpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    zj316_0415 (ack1)
   00640 Propanoate metabolism
    zj316_0415 (ack1)
  09102 Energy metabolism
   00680 Methane metabolism
    zj316_0415 (ack1)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    zj316_0415 (ack1)
Enzymes [BR:lpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     zj316_0415 (ack1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AGE37954
Position
447474..448661
Genome map
AA seq 395 aa AA seqDB search
MQKTLIINAGSSSLKWQLFAMPAETVVASGLVERISMPGSIFTIKYGDHQKFETTVDNLD
QNHAAQMLLAELQRLAIIDSLTEITAVAHRVVAGGETFKQAVEVTPAVLEAIKGLSDFAP
LHNPMEARGIETMAQALPTVKQYAVFDSQFFTDLPEMNAIYSLPYELTQKYHIRRYGEHG
ISHGYLTGRAAELLAKPKDDLNLVTLHLGSGASLAAVKNGRAFDTSMGFTPLTGVTMGTR
AGDVDPAVLPFLMKALKIDDPNEIMMMLNNQSGLLGISGISPDMREIRAQEATNPQAQLS
VEIFVNRIVKYAGSYLTELKRADALIFAGGIGEHNATLRQQIIDELSIFGVTLDPKLNEA
GQEGLISGADSKIKVMLIPTNEELAMVRQVAALQN
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaacattaattattaacgcaggtagttcatcattgaaatggcaattatttgct
atgcctgctgaaacggtggttgctagtggtctcgttgaacggattagtatgcccggttca
attttcaccatcaagtatggtgaccatcaaaagtttgaaacgacagtcgataatttagat
caaaatcatgcggcgcagatgttattggctgaattacagcgattagcaattattgactca
ttaacggaaattacggcagttgctcaccgagtcgttgcgggtggcgaaacgttcaagcaa
gcagttgaagtgacgccagcggtactagaggccattaaggggcttagtgactttgcacca
ttgcataatccgatggaggcacgtggtattgagacgatggctcaggctttaccgaccgtt
aaacagtacgcggtatttgatagtcaattctttaccgatttaccagaaatgaatgcaatt
tacagtttgccatatgaattgacccaaaaataccatattcgccgttacggtgaacatggt
atctcgcatggttacttaaccggtcgggctgcagaactgctggctaagccgaaagatgac
ctcaacctggtgacgttacacttaggtagtggcgcgtcattagctgccgtaaaaaatggc
cgggccttcgacacatcgatgggctttacgccattaacgggtgtcacaatgggaacgcgc
gcgggtgacgttgatccggccgtattgccattcctcatgaaagctttaaagatcgatgat
ccgaatgaaatcatgatgatgcttaacaatcagtctgggttgttaggaatctcaggaatt
tcaccagatatgcgtgaaatccgtgcgcaagaagccacgaatccccaagcccaactatct
gttgaaatttttgtcaatcggattgttaagtatgccggtagctatttgacagaattaaaa
cgggcggatgcgctgatttttgcgggcggcattggcgagcataatgcgaccttgcgccag
caaattattgatgaactgagcatctttggtgtgaccctggatccgaaattaaatgaagcg
ggtcaagaaggactcatcagtggcgcagattccaagattaaagtgatgttgatcccaact
aacgaagaattagcgatggtgcgacaagttgcggcgttgcaaaattaa

DBGET integrated database retrieval system