KEGG   Lactobacillus plantarum ZJ316: zj316_1767Help
Entry
zj316_1767        CDS       T02458                                 

Gene name
fhs
Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
lpt  Lactobacillus plantarum ZJ316
Pathway
lpt00670  One carbon pool by folate
lpt01100  Metabolic pathways
lpt01120  Microbial metabolism in diverse environments
lpt01200  Carbon metabolism
Module
lpt_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:lpt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    zj316_1767 (fhs)
Enzymes [BR:lpt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     zj316_1767 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: AGE39306
Position
1814468..1816123
Genome map
AA seq 551 aa AA seqDB search
MKDIEIAQQVTPEPITAIAAKAGLTVDQIDQYGSTKAKLKLPLPVKKTQRNLILVTSINP
TPAGEGKSTVTIGLGDALTKIGKSTMIALREPSLGPVMGMKGGATGGGYSQVIPMEDINL
HFTGDMHALTAANNTLAALIDNHIQQGNQLGIDQRRIQWKRALDINDRALRHTVIGLGGA
TSGVPREDGFDITVASELMAILCLSENIADLKQRVNRIVIGYTHDRQPVTVADLNVGGAI
TLLLKDALRPNLVQTLAHTPALVHGGPFANIAHGCNSVLATQAGLNLADYTVTEAGFGAD
LGGQKFMDINVPAVGQAPNAVVIVATIRALKLHGGVALQDLATENVAALKAGAANLGHHI
HAMQRYGVPVVVAINEFTADTDAEIHAVKDYCADLGVDAVLADVWGRGGDGATDLAAAVV
DLCAQPSHFQPLSPADADLKTKINDIVTKTYGGANVEYSAKAQRQLRTFAKQGWDHLPVC
MAKTQYSLSDDPKRLGAPTGFTINVREFVPKLGAGFIVALTGNVLTMPGLPKHPAALDMD
ISDDGKISGLF
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatattgaaattgcacagcaagtgacaccagaaccgattacggcgattgcggct
aaagcgggcttgacggttgaccagatcgaccaatatgggagcacgaaggctaaactcaaa
ttaccgttaccggttaagaaaactcaacgcaaccttattttagtaacgtcgattaacccg
acgcctgctggtgagggaaagtcaaccgtgactattgggttaggtgacgcgttgactaag
attggtaagtcaacgatgattgcattgcgggaaccttcattaggaccagttatggggatg
aagggtggcgccactggtggcgggtactcacaagtgattccaatggaagatatcaatttg
cacttcaccggcgacatgcatgccctgacggctgcgaacaacacgctcgcggccttaatt
gacaaccatattcaacaaggtaaccagttgggtatcgatcagcgtcgaattcaatggaag
cgcgcgttggatattaatgatcgggcgctccggcatacggtgattggccttggtggtgca
acgtcgggtgtacctcgtgaagatgggtttgacattaccgtcgcgagtgaactgatggcc
attctctgtctttcagaaaatattgcggacttgaaacaacgtgttaatcgaattgtaatt
ggctacacacatgaccgtcaaccagtgacagttgctgatttgaacgtcggtggcgcgatc
acgttacttttgaaagacgcgttacgtccaaatttagttcaaaccctggcgcatacccca
gcactcgttcatggtggtccgttcgccaatatcgcgcatggttgtaacagtgtacttgcc
acgcaagctggattgaatctagccgactatacggtaaccgaggcgggcttcggtgctgat
ttgggtggtcagaaattcatggatattaacgtgccagcggtcggacaagcgcccaatgcc
gtggtaatcgtggcgacgattcgggctttaaagttacatggtggcgtggctttgcaagat
ttggcaaccgaaaatgtggcggccttgaaagccggtgcggctaatttaggacatcatatc
catgccatgcaacgttatggggtgccagtcgtggtggccatcaacgaatttacggccgat
actgacgccgaaatccatgccgtcaaagactattgtgccgatcttggagtcgatgcagtc
ttggctgatgtctggggtcgtgggggtgacggggcaaccgacttagctgccgcagtggtt
gatttatgtgctcagccaagtcattttcaaccgttatcaccagcggatgcggatcttaag
acgaaaatcaacgatattgtcactaagacgtatggtggagccaatgtcgaatattcagcg
aaagctcagcgccaattgagaacgtttgctaagcaagggtgggatcatttgccagtctgc
atggcgaagacgcaatactcattgagcgatgatcccaaacgtctcggagcaccaaccgga
tttacaattaatgttcgtgaatttgtgccgaagttaggtgcgggtttcattgtcgctttg
accgggaacgtgttgacgatgccaggactgccaaaacatccggccgcactcgatatggac
attagtgatgatggaaaaatctcaggtttgttctaa

DBGET integrated database retrieval system