KEGG   Lactobacillus plantarum ZJ316: zj316_2161Help
Entry
zj316_2161        CDS       T02458                                 

Gene name
recD
Definition
(GenBank) Exodeoxyribonuclease V, alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lpt  Lactobacillus plantarum ZJ316
Pathway
lpt03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lpt00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    zj316_2161 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lpt03400]
    zj316_2161 (recD)
Enzymes [BR:lpt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     zj316_2161 (recD)
DNA repair and recombination proteins [BR:lpt03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     zj316_2161 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 SH3_13 UvrD_C_2 AAA_11 Viral_helicase1 HHH_5 Sigma54_activ_2 T2SSE UvrD_C AAA_22 HTH_IclR AAA_28 AAA_16 TsaE AAA Mg_chelatase AAA_23 AAA_18 AAA_29 UvrD-helicase NTPase_1
Motif
Other DBs
NCBI-ProteinID: AGE39700
Position
complement(2198683..2201232)
Genome map
AA seq 849 aa AA seqDB search
MTDEQAHLFSDDIGREPVTHFIVGKVAAVFFSSADSFYKVLLVKVTEQNIDWSEDEIVVT
GNFADIQEETTYRFTGKTVTHPKYGVQFQADNYQNETPTTRAGLIAYLSGSDFPGLGKRT
AERIVDTLGEDAIDQILADPKVLKPIGLRASVQTTLIDTLTVNNGLEQTIIGLNAYGFGS
RLAAAIYARYQGDTLAKIQENPYCLVEDIKGVGFKKADQIAAQLKIDPQADDRLKAALLT
EINELCVENGDTYTTAQPLLNQTLQLLENARNVQIDPSKLADQLVVLAKENKIVGDENRI
YLRGLYEAEWRVAEHLQRLLAADNDEKLSERAVDHAIEHVGRASNITYDESQTEALKAAI
TAPVFLLTGGPGTGKTTIIRGLVALYAELHDVALDINQYKDKPFPILLAAPTGRAAKRMA
ETTGLPASTIHRLLGLTGREDGPEEPSKELDGGLLIIDEMSMVDTVLFQQLLTAIPSHMQ
VILVGDKDQLPSVGAGQVFHDLLQFSELPQIELTTIYRQGNDSSIIPLAHAIKDGHLPAD
FAVNQPDRSFIACNAYQVNHIVEQVVARAKAKGFSAEEVQILAPIYRGTAGIDQLNTTVQ
KIFNPLKSAHQKHLTYNGQDFRVGDKVLHLVNSPEDNVFNGDIGKIVGIDLANDSHNESK
KDQITIAFDQNEVTYQRNEWNRLTLAYSMSIHKSQGSQFKMVILPLVPQFARMLQRNLLY
TAVTRAEQMLILLGDSQSFERSVTNESVNRQTTLTKRLQQVFGGDTVSDETATIATTDQA
EATPAGEKATAVKKVASDEESATEKTQEPSSQSAGPTILTPALVSAGRIDPMIGMNGITP
ANFMPQVAN
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
gtgacggacgaacaagcacatttattttccgacgatattggtcgggaaccggtcacacac
tttatcgtcggtaaagtcgctgccgttttttttagcagtgccgatagtttttataaagtc
ttattagtcaaagtaactgaacagaacattgattggtcggaagatgagatcgttgttact
ggaaattttgcggatattcaggaggagacaacgtatcgttttaccggtaaaacggtcacg
catcccaaatacggggttcagtttcaagcggataattatcaaaatgaaacgcccacgaca
cgcgcaggcttgattgcctatctatctggtagtgattttcctgggttgggtaagcggact
gctgagcgaatcgtcgatactttgggcgaagatgccattgatcaaattttagctgatccg
aaggttttaaaaccaatcggacttcgggccagcgttcagacgactttgatcgacacgctc
acggtcaataacggtttggagcaaactatcattggacttaatgcgtacggttttgggagt
cggttagctgcggccatctatgcacgctatcaaggtgacactttggctaagattcaagag
aacccgtactgtttggttgaggatatcaaaggcgtcgggttcaaaaaagcggatcaaatt
gcggcccaacttaaaattgatccccaagcggatgaccggttaaaggcggccctattgact
gagattaatgagctgtgcgtggaaaacggtgatacgtataccacggctcaaccgttgctg
aatcaaacgttgcaactacttgagaatgctcgcaatgttcaaattgatccttcgaagctg
gctgatcagttggtcgtcttggcgaaggaaaataaaatcgtgggtgacgagaatcgtatc
tacttgcgcggcctctatgaagccgagtggcgcgttgcggaacatttacaacggttgtta
gccgccgataatgatgaaaaattgtctgaacgtgccgtggatcatgctatcgagcatgtc
ggtcgagctagcaacattacttatgatgaatcacaaaccgaagcactaaaagcggcgatt
acggcgcctgtttttctactaactgggggaccggggactggtaaaacgaccattatccgt
ggcttagtcgcgctctatgcggaattacacgacgttgcactagatatcaatcagtataag
gataagccttttccaatcctgctggcggcaccgactggacgggcagccaagcggatggct
gaaacgactgggctcccagctagtactattcatcggttgcttgggttgacggggcgtgaa
gatggtcccgaggagcctagtaaggaattagatgggggcctcctgattattgacgaaatg
tcgatggttgacacggtactgtttcagcagttactgacggcgattccaagtcacatgcaa
gtcattcttgttggcgataaggatcaactgccatcggtaggagccgggcaagtgtttcat
gatttattgcagtttagtgaactgccccaaattgagttaacgacaatctaccggcagggc
aatgattccagtattattccgttggcccacgccatcaaagatggtcatttaccggccgat
tttgccgtcaaccaaccggatcgctcatttattgcctgcaacgcttatcaagtcaatcac
attgttgaacaagttgtggcacgtgccaaggcgaagggcttcagtgctgaggaggtccaa
attctggccccgatatatcgcggcactgccgggatcgatcagctgaataccacggttcag
aaaatctttaatccgttgaagagtgcccatcagaagcatctaacgtataacggtcaagat
tttcgggtcggtgataaggtcctgcacctcgttaattcacccgaggataatgtttttaat
ggcgacattggtaaaatcgtcggtatcgatctggcaaatgattctcacaatgaatcgaag
aaagaccagatcacgattgcctttgatcaaaatgaagtgacttatcaacgcaatgaatgg
aatcgattgacattagcgtacagtatgtcgatccacaagtctcaagggagccagtttaaa
atggtgattctgccactggtaccacaatttgcacggatgctacaacgcaatctactgtat
actgccgtgacacgtgctgaacaaatgctgatcctgttaggtgatagtcaatcatttgag
cggagcgttaccaatgaatcggttaatcgccaaaccacactgacgaaacggttacaacaa
gtctttggcggggataccgtatccgatgaaacggccactattgcgactactgaccaagca
gaggcaacgccagccggcgaaaaagcgacggcggttaagaaagttgcttctgacgaggag
tcggccactgaaaaaactcaggaaccgagttcccagtctgctggaccaacaattttgacc
ccagcgctagtcagcgctggccgaatcgatccgatgattggcatgaatggtatcacgcca
gctaatttcatgccgcaagtagctaattga

DBGET integrated database retrieval system