KEGG   Legionella pneumophila subsp. pneumophila LPE509: LPE509_00348Help
Entry
LPE509_00348      CDS       T02511                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
lpu  Legionella pneumophila subsp. pneumophila LPE509
Pathway
lpu00360  Phenylalanine metabolism
lpu00362  Benzoate degradation
lpu01100  Metabolic pathways
lpu01120  Microbial metabolism in diverse environments
lpu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lpu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    LPE509_00348
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LPE509_00348
   00622 Xylene degradation
    LPE509_00348
   00621 Dioxin degradation
    LPE509_00348
Enzymes [BR:lpu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     LPE509_00348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-ProteinID: AGH52439
Position
complement(368060..368947)
Genome map
AA seq 295 aa AA seqDB search
MNPVSILDASLRDGGHRTNFHFKDDDLKKILLPLDNSGIEYIEIGYRNGSLHPIENIGKA
GMCPQDYLLYCQSLIKKAKIAVMVHPHNVNEQDLFELKNCGVKLIRICIAKGDLVNAVPL
IKLAKNLNFETSVNIIHISYYTESELDSLIEEVSEHEPDMIYFADSNGSLFPDRINCLYK
KYTRQYKVSFGFHAHDNLGLAQANALAAVNAGVHFIDASLAGMGKGTGNLKTEFFIAYLH
ANNIKKYNLEDVLTAANYVRDALKIGQEPIEMSEFIRGISDLSTADLKSYKPGKL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctgtatcgattttagatgcctcattaagagatggtggacatagaactaatttt
cattttaaggatgatgatttaaaaaaaatactacttcctcttgataactcaggtattgaa
tacattgaaattggctaccgtaatggttcacttcaccctattgaaaatatagggaaagct
ggaatgtgtccccaagattatctcctgtattgccaatctctaataaaaaaagcaaaaatt
gcagtgatggttcatcctcataatgtaaacgaacaggatctgttcgagctaaaaaattgc
ggtgtgaaattaataagaatatgtatagcaaaaggtgatctggtaaatgctgtccctctg
attaaactggctaagaatttgaattttgaaacctcagtgaacatcatccatatttcttat
tatacggaaagcgaactggatagtttgattgaggaagtaagcgaacacgaaccggatatg
atctattttgctgattctaatggaagcttatttcctgacaggataaattgcctgtataaa
aaatacacccgtcaatataaagtttcttttggatttcatgctcatgataaccttggattg
gcgcaagccaacgctcttgcggcggtaaacgccggggttcattttattgatgcctcactg
gcaggaatgggcaagggaacaggtaatctaaaaactgaattttttatcgcttatttacat
gcgaacaatataaaaaaatacaatttggaagatgtgttgacagcagctaattatgtaaga
gatgccttgaaaataggacaagaacctattgaaatgagtgaattcataaggggaatttct
gatctgtctacagcagacctgaaaagctataaaccaggcaagctctag

DBGET integrated database retrieval system