KEGG   Legionella pneumophila subsp. pneumophila LPE509: LPE509_01126Help
Entry
LPE509_01126      CDS       T02511                                 

Definition
(GenBank) Hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lpu  Legionella pneumophila subsp. pneumophila LPE509
Pathway
lpu00900  Terpenoid backbone biosynthesis
lpu01110  Biosynthesis of secondary metabolites
lpu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lpu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LPE509_01126
Enzymes [BR:lpu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     LPE509_01126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AGH53217
Position
complement(1176375..1177673)
Genome map
AA seq 432 aa AA seqDB search
MSIAANAGELFRGFSKLSREERFQRLCALGALTHEDITFLKQGGIKDLNLADKLIENVIG
YFQLPLGVATNFNIDGRDYVIPLAVEETSIIAALSKSAKWIRQHGEINTWVHGECILGQI
QLAKIKDFQRFSDLFNKNRQYFIEIANKDVAANMVKRGGGVTDLQVRHLKRDDGQDMAVI
HLTMNSCDAMGANIINQVLEYLKQPIEQITGEEVTMCILSNLNDQKLTTAQVIIRNIDPI
LGQKLQEASLFAEIDPYRAATHNKGVMNGIDPVLIATGNDWRAVEAGIHAYAARSGQYKA
ITRWRYQNEILTGELTAPIIVGTVGGVTSLHPTAKMCLRMMDITSANQLSQVIAAVGLVQ
NLGALKALCTDGIIQGHMKLHIDNLLLVAGANENEMPVLKEKLQEWLNLNKRVSLNNAYD
LLAEIRQAPVAV
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtccatagctgctaatgccggtgaattatttcgcggattctcaaagttatcacgtgaa
gagcgctttcaaaggttatgcgctttaggtgccttgactcatgaagacataacatttctt
aaacaaggtggtattaaagatttaaacttggccgacaaattgattgaaaatgtgattgga
tattttcagcttccattgggtgtggctactaattttaatattgatggacgtgattatgta
atacctttggcagtggaagaaacctctattattgctgctctttccaaatcagcgaaatgg
attaggcagcatggtgaaatcaatacctgggttcacggagaatgtattcttgggcaaatt
caactggcaaaaataaaggactttcaaagattctctgacctctttaataaaaatcgtcaa
tattttatagaaatagcgaataaagacgttgccgccaatatggtcaaacgaggcggcggt
gttacggatttgcaagtacgtcatttaaagagagacgatggacaagatatggcagtaatt
catttgacgatgaacagctgcgatgctatgggtgccaatatcatcaatcaagtacttgaa
tatttaaaacaacccatagaacaaataactggtgaagaagtcaccatgtgtattttatcg
aacttaaatgatcaaaaattaacgaccgctcaagtcatcattcgtaatattgaccccatc
ctcggtcaaaaattgcaagaggcctcactctttgcagaaatagatccctatcgcgctgct
acccataataaaggggttatgaatggaattgatccggttttaattgctacagggaatgat
tggcgagctgtggaagctggaatacacgcctatgcggcacgttcgggacaatacaaagca
attactcgctggcggtatcaaaatgaaatactcacaggagagttaactgctcctatcata
gtaggtactgttggaggcgtaacctctttacaccccacggctaaaatgtgtttacgaatg
atggatatcacttctgccaatcaactctcccaagtcatcgcagcagttggactagtgcaa
aatcttggcgcactcaaagctttatgcactgacgggatcattcaaggccatatgaaattg
catattgataatttgctattagttgcaggggctaatgaaaatgaaatgcccgtgctcaaa
gaaaaattgcaagaatggcttaacctgaacaaacgagtcagcttgaataacgcttatgac
ctattagctgaaatccgacaagctcctgttgcagtatga

DBGET integrated database retrieval system