KEGG   Limnobaculum parvum: HYN51_01265Help
Entry
HYN51_01265       CDS       T05491                                 

Definition
(GenBank) two-component system sensor histidine kinase QseC
  KO
K07645  two-component system, OmpR family, sensor histidine kinase QseC [EC:2.7.13.3]
Organism
lpv  Limnobaculum parvum
Pathway
lpv02020  Two-component system
lpv02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lpv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HYN51_01265
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    HYN51_01265
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lpv01001]
    HYN51_01265
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:lpv02022]
    HYN51_01265
Enzymes [BR:lpv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     HYN51_01265
Protein kinases [BR:lpv01001]
 Histidine kinases
  OmpR family
   HYN51_01265
Two-component system [BR:lpv02022]
 OmpR family
  QseC-QseB (quorum sensing)
   HYN51_01265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA 2CSK_N HATPase_c_3 4HB_MCP_1
Motif
Other DBs
NCBI-ProteinID: AWH87306
UniProt: A0A2Y9TUI7
Position
1779380..1780726
Genome map
AA seq 448 aa AA seqDB search
MKRLSLRTRLILIFTILILLSWVISSAIGYVKVRHRIRLAYDAEQIMFAKRLERSGLDDL
LAIQAKNNNTSFRSDRFNQARDAFSFAIFSIDGKKLITDRDDVPDFIYSPTETKLGESPE
FRESKLWRVLWLKSQDQRFIIAVGQKNVYRTRFARSILLDHQVTPWGIMIPIMLLIITLM
INRELVPLKRVTSELKLRKPDDETPIEGKRLPLEVQPFVDALNMLFARIGDMLKRERRFV
SDAAHELRSPLTALRVQAEVAQITVNKPEAQRKALNNLTIGIDRASRLVDQLLTLSRLDA
QSGIPEQETINWQSLIQDMQPTFFASAKEKQINLQINYQGMPADRHGNAVLLSLLIRNLV
DNALHYTPAEGSVSVTLTDQQLVIEDSGPGVTQEHLQRLGERFYRPPGQTKTGSGLGISI
VKQIAELHGLTLSFTNREEGGFRVRVGF
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagattaagcttgcgtactcgccttatcttgatttttactattcttattctgctt
tcttgggttatttcgtcagccattggttacgttaaagttcgccaccgtattcggctggcg
tatgatgcagaacagattatgtttgctaaacgactggagcgttctggactggacgatctg
ctggcgatacaggctaaaaacaacaatacttcatttcgatctgaccgatttaatcaagct
cgtgatgcattctcatttgctattttcagtatcgatggcaaaaagctgattaccgatcgg
gatgatgtgcccgatttcatttattctccaacagaaaccaaactgggagagtcgccggag
ttcagggaaagtaaactatggcgagtgctgtggcttaagtctcaagaccagcgctttatt
atcgcggtcgggcaaaaaaatgtctatcggacgcggtttgctcggtcgattctactggat
catcaggtaaccccttgggggatcatgatcccgattatgctactcattatcacgctgatg
attaatcgtgagttagttccacttaagcgggtgacttcagagcttaaactgcgaaaaccg
gatgatgaaacgccgattgaagggaaacgtttaccgttagaagttcaaccctttgttgat
gcactcaacatgctatttgcccgcattggcgatatgttaaagcgcgagcgacgctttgtt
tcggatgctgctcatgagttacgtagcccgttaactgcgcttcgggttcaggctgaagtg
gcacagataacggtaaataaaccggaagcacagaggaaagcgctaaacaacctgactatt
ggtatcgatcgcgcttcccgactggtagaccagttattgacattatcgcggttggatgct
caatccggtattccagagcaagaaacgattaactggcagtcgttaatacaggatatgcag
ccgactttttttgccagcgcaaaagagaagcagatcaatctgcaaattaactatcaaggt
atgccggctgataggcatggtaatgcggttctgctgtcactcttaattcgtaatttggtg
gataacgcattgcactatacaccggctgagggttcggtcagcgtcaccttaacggatcaa
cagctcgtcattgaagacagcggcccgggtgtcactcaggaacatttgcaacggctggga
gaacgtttttaccgacctccggggcaaacaaaaaccggcagtggtttgggtatctccatc
gttaagcaaattgccgaactgcatggcctgacacttagcttcaccaaccgtgaagagggt
ggattcagggttagggttggtttctaa

DBGET integrated database retrieval system