KEGG   Limnobaculum parvum: HYN51_01340Help
Entry
HYN51_01340       CDS       T05491                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
lpv  Limnobaculum parvum
Pathway
lpv00010  Glycolysis / Gluconeogenesis
lpv00071  Fatty acid degradation
lpv00350  Tyrosine metabolism
lpv00625  Chloroalkane and chloroalkene degradation
lpv00626  Naphthalene degradation
lpv00680  Methane metabolism
lpv01100  Metabolic pathways
lpv01110  Biosynthesis of secondary metabolites
lpv01120  Microbial metabolism in diverse environments
lpv01130  Biosynthesis of antibiotics
lpv01200  Carbon metabolism
lpv01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lpv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HYN51_01340
  09102 Energy metabolism
   00680 Methane metabolism
    HYN51_01340
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HYN51_01340
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    HYN51_01340
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HYN51_01340
   00626 Naphthalene degradation
    HYN51_01340
Enzymes [BR:lpv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HYN51_01340
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     HYN51_01340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C MinC_C Met_10 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AWH87321
UniProt: A0A2Y9TUR0
Position
1795470..1796588
Genome map
AA seq 372 aa AA seqDB search
MKSRAAVAFEAGKPLQIVEIDVAPPKKGEVLVRITHTGVCHTDAFTLSGDDPEGVFPAVL
GHEGGGIVVEIGDGVTSLKPGDHVIPLYTAECGECKFCKSGKTNLCQAVRATQGKGLMPD
GTTRFSYNGQPIYHYMGTSTFSEYTVVAEISLAKINPEAPLEKVCLLGCGVTTGIGAVHN
TAKVKAGDTVAIFGLGGIGLAAIQGAVQAKAGRIIAIDINQDKFKLAKEMGATDCINPKD
YDKPIQDVIVEMTDGGVDYSFECIGNVDVMRSALECCHKGWGESVIIGVAGAGQEIRTRP
FQLVTGRVWRGSAFGGVKGRSQLPGMVEQAMRGDIQLDPFITHTLPLEEINQAFDLMHEG
KSIRTVIHFGDK
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctcgtgctgccgtggcttttgaagccggaaaaccattacagatcgttgaaatt
gatgttgctccaccaaagaaaggcgaagtattagtgcgtatcacccatactggcgtgtgc
catacggatgcctttacgttatccggtgacgatccggaaggggttttccctgcggtatta
ggccatgaaggcggtggtattgtggttgaaattggtgacggtgtcacgtcattaaagccc
ggggatcatgtgattccgttatataccgccgaatgcggtgagtgtaagttctgtaagtca
ggaaaaactaacctgtgtcaggcggtacgcgccactcagggcaaagggctaatgcccgat
ggcacaacccgattctcctataacggtcagccaatttaccactatatgggcaccagtaca
ttcagtgaatacacggtagttgcggaaatctcgctggcaaaaataaatcctgaagcaccg
ctggagaaagtttgcttattgggttgtggtgtaacgaccggcattggtgccgttcacaat
accgcgaaagttaaagcgggagatacggtggctatctttggtttaggcggcattggttta
gcggctattcaaggcgcagtacaggctaaagcggggcggattattgccattgatatcaat
caggacaaatttaaactggcgaaagagatgggtgcgacagactgcatcaatcctaaagat
tacgataagcctattcaggatgtgattgtagaaatgaccgatggcggggtggattatagc
ttcgaatgtatcggtaatgtggatgtgatgcgctcggcgctggagtgttgccataaaggt
tggggggaaagtgtgattatcggcgtagccggtgcaggtcaagagatccgcacacgtcca
ttccaattggttactggacgcgtatggcgcggttctgcctttggcggagtaaaagggcgt
agtcagttaccgggtatggttgagcaggctatgagaggggatattcaactcgatccattc
attacccatacgttaccgctggaagagattaatcaggcgtttgacttgatgcatgaaggt
aaatctattcgtaccgttatccactttggcgataaatag

DBGET integrated database retrieval system