KEGG   Limnobaculum parvum: HYN51_05815Help
Entry
HYN51_05815       CDS       T05491                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
lpv  Limnobaculum parvum
Brite
KEGG Orthology (KO) [BR:lpv00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    HYN51_05815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 AvrM_N
Motif
Other DBs
NCBI-ProteinID: AWH88119
UniProt: A0A2Y9TX97
Position
2799551..2799928
Genome map
AA seq 125 aa AA seqDB search
MIDKPRVFIQAQSFYVEAQSLPDEERFVFAYTMTVRNLGREQVQLLSRYWLITNANGKHT
EVQGEGVIGEQPVILAGSEFQYTSGAILETPLGTMEGHYNMIDHMGQPFQIVIPVFRLAI
PSLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgataaacccagagtttttattcaggcacaaagtttctatgttgaagcccagtct
ttgccggatgaagagcgatttgtttttgcttataccatgacagttcgcaatctgggccga
gagcaggtacaacttcttagccgatattggctaatcactaatgctaacggcaaacacact
gaagttcagggtgaaggcgtgattggtgagcaaccggttattttggcaggcagtgagttt
caatataccagcggcgctattctggaaacgccgttgggtacaatggaaggccattacaat
atgattgatcatatggggcaaccatttcagatagtgattccggtattccgtctggcgatt
ccgtctctgattcactaa

DBGET integrated database retrieval system