KEGG   Limnobaculum parvum: HYN51_12900Help
Entry
HYN51_12900       CDS       T05491                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system aminomethyltransferase GcvT
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
lpv  Limnobaculum parvum
Pathway
lpv00260  Glycine, serine and threonine metabolism
lpv00630  Glyoxylate and dicarboxylate metabolism
lpv00670  One carbon pool by folate
lpv01100  Metabolic pathways
lpv01110  Biosynthesis of secondary metabolites
lpv01130  Biosynthesis of antibiotics
lpv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lpv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HYN51_12900 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HYN51_12900 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    HYN51_12900 (gcvT)
Enzymes [BR:lpv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     HYN51_12900 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: AWH89367
UniProt: A0A2Y9U067
Position
718624..719730
Genome map
AA seq 368 aa AA seqDB search
MTNKTPLYDRHLACGARMVDFHDWMMPLNYGSQIDEHHAVRQHAGMFDVSHMTIVDLHGV
NTREYLRYLLANDVVKLTQPGKALYSAMLNASAGVIDDLIVYFLAEDYFRLIVNSATREK
DLAWITEHAQPFTVEIQVRDDLGLIAVQGPEAKQRVATLLTDQQCQAVNQMKPFFGVQSG
DVFIATTGYTGEEGYELMMSASQLDDWWQKLMAAGVKPCGLGARDTLRLEAGMNLYGQEM
DEGVSPLAANMEWTIAWEPADRDFIGRARLEILRKQGTDKLVGLVMTEKGVLRNELPVMF
YDAAGKEHQGVITSGSFSPTLGCSIALARVPQGIGDVAIVPIRNREMPVRVVKPGFVRNG
RTLLAPTE
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaccaataagacccctctgtacgatagacacctcgcctgtggtgccagaatggttgat
tttcatgattggatgatgccgctgaactacggttcacaaattgatgaacaccacgctgta
cgccagcatgcaggcatgtttgatgtttcccacatgaccatcgttgatttgcacggtgtt
aacacccgtgaatatcttcgttatctgctagcaaatgatgtcgtcaagttaactcaacct
ggtaaagcgctgtacagtgcgatgttgaatgcatcggcaggggtgattgacgatctgatt
gtctattttctggcagaagattatttccgtttgattgtgaactccgctacgcgagaaaaa
gatctggcgtggattaccgagcatgcccagccctttactgtcgaaatacaagtccgcgat
gacttaggattaattgcggtgcaagggcctgaggctaaacaacgcgtagcaaccctactg
acggatcaacagtgtcaggcggttaaccagatgaagcctttctttggcgttcagtccggc
gatgtgtttattgccaccactgggtatacgggggaagagggctatgaactgatgatgtcc
gcgagccaactggacgactggtggcagaagctgatggcggcaggcgtgaaaccttgtggt
ttaggcgctcgtgacacattgcgtctggaagccggcatgaatctgtatggtcaagagatg
gatgagggggtttccccactggcagcgaatatggagtggacgattgcttgggagccagcg
gatcgtgactttattggtcgtgcaaggttagagattttacgtaagcagggtaccgacaag
ctggttggcttggtgatgactgaaaaaggcgtgctgcgcaatgagctgccggtgatgttt
tatgatgcagccggtaaagaacatcagggggtgatcaccagtggttctttctcccctacg
ctgggttgcagtatcgcattggcgcgggttcctcagggtattggtgatgtagccatcgtg
ccaattcgcaaccgtgaaatgccggtgcgggtggtgaaacccggatttgtgcgtaacggc
agaacactgctggcaccaacagaataa

DBGET integrated database retrieval system