KEGG   Limnobaculum parvum: HYN51_13535Help
Entry
HYN51_13535       CDS       T05491                                 

Definition
(GenBank) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
lpv  Limnobaculum parvum
Brite
KEGG Orthology (KO) [BR:lpv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lpv03016]
    HYN51_13535
Enzymes [BR:lpv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     HYN51_13535
Transfer RNA biogenesis [BR:lpv03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    HYN51_13535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 FliG_N
Motif
Other DBs
NCBI-ProteinID: AWH89482
UniProt: A0A2Y9U0Z5
Position
865146..865925
Genome map
AA seq 259 aa AA seqDB search
MLDILYQDEHLIAVNKPSGWLVHRSWLDRHEKVVVMQTVRDQIGQHVFTVHRLDRPTSGV
LLMALSSEVARQMSQQFEHHQINKVYHAVVRGHVHEADTIDYPLVEQLDKIADKFAKQDK
DAQPAISHYRGLSQVEVPIAVGPYDTARYSLVELTPQTGRKHQLRRHMKHIFHPIIGDSA
YGDLRHNRAVVEHFGCQGLMLHASHLALQHPVTHQPLLISAPWDSRWQNLMTEFGWSSQC
PEYNGVEINLAITQDSLVR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgctggatattttgtatcaagatgaacatttgatcgcggtaaataaaccttctggatgg
ttagttcatcgtagttggttggatagacatgaaaaagtagtggtgatgcaaacggtgcgt
gaccagattggtcagcatgtttttaccgtacatcgccttgaccgcccaacgtcgggagtg
ttgttgatggcgctctccagtgaggtggctcgtcaaatgtcccaacagtttgaacatcat
cagattaataaggtctatcacgcggtggttcggggacacgttcatgaagcggatactatt
gattatcctttagtggaacagctggataagatcgccgataagtttgccaaacaggataaa
gacgctcagcctgccatcagccattatcgggggctctcacaggttgaggtgcctattgcc
gttgggccttatgataccgcgcgttatagtctggtagagttgacgcctcaaacgggtcgt
aagcatcagcttcgtcgccatatgaaacatattttccatccgattattggcgatagcgcc
tatggtgatttacgccataatcgtgcggtagtcgaacattttggctgtcaggggctgatg
ttacatgccagtcatttagcgcttcaacatccggttactcatcagccattacttatttct
gccccttgggattctcgctggcaaaacttaatgacagaatttggatggagctcgcaatgc
cctgaatataatggggttgaaattaatttggcaataactcaggatagcttggtcagataa

DBGET integrated database retrieval system