KEGG   Lactobacillus paraplantarum: ASU28_09500Help
Entry
ASU28_09500       CDS       T04156                                 

Definition
(GenBank) 23S rRNA methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
lpx  Lactobacillus paraplantarum
Brite
KEGG Orthology (KO) [BR:lpx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lpx03009]
    ASU28_09500
Enzymes [BR:lpx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     ASU28_09500
Ribosome biogenesis [BR:lpx03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ASU28_09500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_23 MetW DUF2512 Arb1
Motif
Other DBs
NCBI-ProteinID: ALO04576
Position
complement(2047017..2047871)
Genome map
AA seq 284 aa AA seqDB search
MKKIDRGIQFVQANIGRLRCLVCNQAYVTIDGHSLCCPNGHQVDFSKKGTLYFLTHQVAS
EYDANMLAARRRVLQAGLFGPIVQAINAALPKTAQRILDIGSGEGTPLADLLTLHANPAD
VGIGFDISKDGVNLATQLTTSAYYCVADLAQLPFTDGAFTAIMDVFSPSAYQEFERVLAP
GGQLLKIVPNPEYLVELRHLLFKPTDRQYQYDNQRVLDLFAQHYPAAKRQRIQYQVALDD
IDFNDLLVMTPLHWGADAEQLTIAKQQGLNKITVDVSLLTMQKG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaattgaccgcggcatccagtttgttcaggcaaacattggccgccttcggtgc
ttagtttgtaaccaagcatatgtgacaattgacggccacagcttatgctgtcccaatggg
catcaagtggatttttctaaaaaagggacgttgtattttttgacgcatcaggttgctagt
gaatatgatgccaatatgttagcggcccgccgtcgcgttttgcaagctggccttttcggc
cccattgtccaagccattaatgcggcgttgccaaaaacggcgcaacgaatcttagatatt
ggtagtggtgaagggacgccgctagctgacttgctgacattacatgctaatcctgctgat
gttgggattggctttgatattagtaaagacggggttaacttagccacccaattgacaaca
tccgcttattattgtgtggcagatttggctcagttgccttttactgatggagcgtttacg
gctattatggacgttttctcgccatccgcttaccaagagtttgaacgggtactagccccc
ggtgggcagttactgaagattgtgcctaatcctgaatatttagttgaactgcgtcacctg
ttatttaagccaactgatcgccaatatcagtatgataatcaacgtgtgttagatctattt
gctcagcattacccagctgctaagcggcaacgaattcaatatcaggttgcacttgatgac
attgactttaacgacttattagtaatgacgccactgcactggggggcggatgctgaacaa
ttgacgattgctaaacagcaaggactaaacaagattacggttgatgtgagtttactgacg
atgcaaaaaggttaa

DBGET integrated database retrieval system