KEGG   Luteibacter pinisoli: FIV34_01680Help
Entry
FIV34_01680       CDS       T06035                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
lpy  Luteibacter pinisoli
Brite
KEGG Orthology (KO) [BR:lpy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lpy03016]
    FIV34_01680
Enzymes [BR:lpy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     FIV34_01680
Transfer RNA biogenesis [BR:lpy03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    FIV34_01680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: QDE37992
Position
complement(364621..365349)
Genome map
AA seq 242 aa AA seqDB search
MLEILYQDDDIVAVNKPANLAVHRSKFVGPDDAFLIDLLREQVDGRLHLAHRLDRATSGV
LLVARSSEVASLLGEQFMGRTVSKRYLAVVRGWPDPEEGTIDYALPGSRDTGPRREASTD
YRRLATVEVDIPLGRYDKQRYALMLAEPRTGRFRQIRKHFAHIHHPIVGDSQHGRGDHNR
LFKQHFSSHRLLLHAERLTFTHPRTGADLAISASIDDTMQRVFSRFGWTDALGAVGISAA
SS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagattctttaccaggacgacgacatcgtcgccgtcaacaagcccgcaaacctc
gcggtgcatcgttccaagtttgtgggcccggatgatgcgttcctcatcgacctgctccgc
gagcaggtcgatgggcgcctgcacctggcccaccggctggaccgtgcgacatccggcgtc
ctgctcgttgcccgctcatcggaagtcgccagcctgctcggtgagcagttcatgggccgc
acggtgagcaagcggtacctcgccgtggtgcgtggatggcccgaccccgaagaaggcacc
atcgactacgccctgcccggctcccgcgataccggcccacgccgcgaggccagcaccgac
taccgccgtctcgccacggttgaggtcgacatcccgctgggccgctacgacaagcaacgc
tacgcgctgatgctggccgaaccgcgcacgggccgtttccgccagatccgcaagcacttc
gctcatatccatcatccgatcgtcggcgacagccagcacggccgcggcgaccacaaccgc
ctgttcaagcagcacttcagttcgcaccggctgttgctgcatgcggagaggctgacgttt
acccacccccgaacgggcgccgacctggcgatcagcgcgtcgatcgatgacacgatgcaa
cgggttttttcccgattcggctggaccgacgcgctgggtgcggtgggcatctcagcggct
tcgtcctag

DBGET integrated database retrieval system