KEGG   Luteibacter pinisoli: FIV34_07120Help
Entry
FIV34_07120       CDS       T06035                                 

Definition
(GenBank) amino acid lyase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
lpy  Luteibacter pinisoli
Pathway
lpy00260  Glycine, serine and threonine metabolism
lpy01100  Metabolic pathways
lpy01110  Biosynthesis of secondary metabolites
lpy01120  Microbial metabolism in diverse environments
lpy01130  Biosynthesis of antibiotics
lpy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lpy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FIV34_07120
Enzymes [BR:lpy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     FIV34_07120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase OKR_DC_1 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: QDE38985
UniProt: A0A4Y5Z380
Position
1547228..1548394
Genome map
AA seq 388 aa AA seqDB search
MVSRREFLQAVPIGALSLAAAAHPLALAAAPAPAEKPLAVEKIVALVGDDVPVRSMYLPQ
RLEAAIAGNAEVGDLYLHDGAVGALEKRFAELLGKEDAAFMPTGTMANQIAVRILCGDRR
HLLLQKESHVYRDEEDATPVLSGINPVPIDGGTSEALVASVQAAFNQRSKDPYPMEVGAI
SLESPVRRLDGSTTALDTILRIADIAKKNGTGMHLDGARLLLMSGMEGFDPKTYAVPFDT
VYVSLYKYLGAPFGAILAGDKARIDRARHVRHIFGGTIFRGYPAAALALHGLDHFGERFA
RVRAAGEALLAKLAGMPGIRIERVDRGSNIAIAILDAKVADGLRERARSADIVVGKPDNG
RLHLTFNETLLRKPTATIAKVFAADGVG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggtcagtcgtcgtgagttcctccaggccgtgccgatcggtgccttgtccctggccgcc
gcagcccatccgctggcgctggcggccgcgcccgcccccgccgagaagcccctcgccgtc
gagaagatcgtggcactggtgggcgacgatgtgccggtgcgctccatgtatcttccgcag
cggctcgaagcggcgatcgccgggaatgccgaggtaggcgacctctacctgcatgacggc
gccgtgggcgcgctggagaaacgcttcgctgagttgcttggcaaggaggatgccgccttc
atgccgacgggcacgatggccaaccagatagccgtccgtatcctctgcggcgatcgccgt
catttgctgctgcagaaggagagccacgtctaccgtgacgaggaagacgcgacgcccgtg
ctcagcggcatcaatccggtaccgatcgacggtggaaccagcgaggccctcgtggcttcc
gtgcaggcggccttcaaccagcgctcgaaggatccgtatccgatggaggtgggtgccatt
tcgctggaaagcccggtgcgccgcctggatgggtccaccaccgccctcgataccatcctg
cgtatcgccgacatcgcgaagaagaacggcaccggcatgcatctggatggcgcgcggctg
ttgttgatgtcagggatggaagggtttgatccgaaaacctacgcggtgccgttcgatacg
gtctacgtgtcgttgtacaagtacctgggcgcgccgttcggcgcgatcctcgcgggcgac
aaggcgcgcatcgaccgcgcgcggcatgtgcgccacatctttggcggcacgatcttccgc
ggctatccggctgccgccctggccttgcatggcctggaccatttcggcgagcggttcgca
cgcgtgcgtgcggcgggtgaggccttgctggcgaaactcgcgggcatgcccggtatccgc
atcgaacgcgtggatcgtgggagcaatatcgccatcgccatccttgatgccaaggtggcc
gatggcttgcgcgagcgcgcacggagcgcggacatcgtcgtcggcaagccggacaacggg
cgtctgcacctcacgttcaacgagacattgctgcgcaagcccaccgctaccattgctaaa
gtgttcgctgcggatggtgtggggtag

DBGET integrated database retrieval system