KEGG   Lactobacillus plantarum 16: Lp16_0014Help
Entry
Lp16_0014         CDS       T02698                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lpz  Lactobacillus plantarum 16
Pathway
lpz00330  Arginine and proline metabolism
lpz00332  Carbapenem biosynthesis
lpz01100  Metabolic pathways
lpz01130  Biosynthesis of antibiotics
lpz01230  Biosynthesis of amino acids
Module
lpz_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lpz00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Lp16_0014
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Lp16_0014
Enzymes [BR:lpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Lp16_0014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: AGO06729
UniProt: R9WXP4
Position
16596..17393
Genome map
AA seq 265 aa AA seqDB search
MKVIRKLKAKRVVIKVGTSTLVYPDGSINLRAIDQLAFVISAMRHRGREVVLVSSGAIGV
GLNYMGLKQRPKAIPEQQAIAAIGQTELISIYKERFAIYEQKIGQLLLTRDIFVYPKSHH
NVLNTFEALLKQNVVPIVNENDTVAVDELDHETKFGDNDQLSAIVATNIGADLLIMLSDI
DGFYDGNPNADARAQLLGHIEKVDQHTYKLAGGSGSRFGTGGMVTKLKAAERMIDANGQM
ILANGADPTIIFQILAGEPVGTLFG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtgatacgaaaactaaaggctaaacgagtcgtgattaaagtcgggacaagcacg
ctagtttatccagatggatcgatcaacttacgggcaatcgatcaattagcctttgttatt
agcgcaatgcgacaccgtgggcgtgaagttgtcttggtttcgtcaggggctattggtgtt
ggcttgaattatatgggactcaagcaacgtccaaaagcaattcctgaacaacaggcgatt
gcggcgattgggcaaactgaattgatttcgatttacaaagaacgtttcgccatttatgaa
caaaaaattggccagttgttattaacacgtgatatctttgtttatcctaagagtcaccat
aatgtgttgaatacatttgaggcgctattaaaacaaaacgtggtcccaattgttaatgaa
aatgatacggtcgcggtcgatgaattggatcatgaaacaaagttcggtgataacgatcaa
ctatccgcaatcgtggccacgaatatcggggcggatttgttaatcatgctatccgacatc
gatggcttttatgatggtaatcccaatgcggatgcccgagcccagttattagggcacatt
gagaaggttgatcaacatacttataagctagctggcggtagtggcagtcggtttggtact
ggtgggatggtcactaagctaaaagcggcagaacggatgatcgatgcgaatggtcaaatg
attttagccaatggtgcggatcccacaattatttttcaaattttagcaggcgaaccagtc
ggaacgctattcggttaa

DBGET integrated database retrieval system