KEGG   Lactobacillus plantarum 16: Lp16_1548Help
Entry
Lp16_1548         CDS       T02698                                 

Definition
(GenBank) aspartate-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
lpz  Lactobacillus plantarum 16
Pathway
lpz00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:lpz00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Lp16_1548
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lpz01007]
    Lp16_1548
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lpz03016]
    Lp16_1548
   03029 Mitochondrial biogenesis [BR:lpz03029]
    Lp16_1548
Enzymes [BR:lpz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     Lp16_1548
Amino acid related enzymes [BR:lpz01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Lp16_1548
Transfer RNA biogenesis [BR:lpz03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Lp16_1548
 Prokaryotic type
   Other AARSs
    Lp16_1548
Mitochondrial biogenesis [BR:lpz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Lp16_1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2b tRNA_anti-like
Motif
Other DBs
NCBI-ProteinID: AGO08233
Position
complement(1668615..1670411)
Genome map
AA seq 598 aa AA seqDB search
MKRTTYAGLINEDYLGQTVTLQGWVQKRRDLGSLIFIDLRDREGIVQLVFSQEFSADALA
VADQLRGEYVIEVQGTVVNRNADAVNDRMKTGKVEVEIHDAKILNKAKTPPFYIQDDINV
SDELRLKYRYLDLRRPEMQRGLKIRNGITQAVHSYFDANGFYDIETPFLTKSTPEGARDY
LVPSRVYQGHFYALPQSPQLFKQLLMGAGFDRYYQIARCFRDEDLRGDRQPEFTQIDMET
SFLTAEEIQSYTEGLIKQVMKDVKGVDIKTPFTRMTWQEAMDRFGSEKPDVRFGMELKDM
GAAVSNAGFKVFDNALANGGLVKAIAVPGGADQYSRKQIDAYTEYVKRFGAKGLAWMKVT
DDGFSGPVAKFFKNDGDFEAITSAAAAKPGDLLLFAADSFKVVSDTLGYLRTAIAKELDL
IDQDQYAYLWVVDWPLFEYDEGIERWVPAHHPFTMPNEEDVHYLNDGEDPHKAHAQSYDI
ILNGYELGGGSIRIHTRELQEKMFKALDFTKERAQEQFGFLLDALDMGFPPHGGLAIGLD
RFAMLLSGNDNIREVIAFPKNSKASEPMTNAPSRVSDQQLADLDLNITNPVTDDEPTE
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggaccacatatgcgggtctcatcaatgaggattatttaggccaaacggtcact
ttacaaggttgggtacaaaaacgccgcgaccttgggagtttgatttttattgatttacgg
gaccgtgaaggaattgtgcaattagtctttagtcaggaattttcagcggatgctttggcg
gtagcagatcagttacggggcgaatacgtcattgaagtgcaaggaaccgttgttaatcgg
aatgctgacgctgttaatgaccgcatgaagactggtaaagttgaagttgagattcacgat
gccaaaatcttaaataaggcgaaaaccccgccattttatattcaagatgatattaacgta
tcagatgaattgcgcttgaagtaccgttacttggacttgcgtcggccagaaatgcaacgt
ggattgaaaattcgtaatggcatcacccaagcagttcatagctattttgatgccaacggg
ttctatgatattgaaacgccgttcttaacgaagtcgacgccagaaggggcccgggattac
ttagtgccttcgcgggtctatcaagggcatttttacgcgttaccacaatcaccacaactc
tttaagcaattgctgatgggggccggttttgatcgctactatcaaattgcacgctgtttc
cgtgatgaagatttgcggggtgaccgtcagcctgaatttacccagattgatatggagaca
tccttcttaacggctgaggaaattcagtcctatactgaaggcttgattaagcaagtcatg
aaggacgtcaagggtgttgacatcaagacgccgtttacgcggatgacttggcaagaagct
atggaccgttttggttctgaaaagccggatgtgcgctttggtatggaactcaaagacatg
ggcgcggccgtttctaacgccggttttaaagtctttgataatgcactcgctaatggtggc
ctggtcaaggcgattgcagttcctggcggtgctgatcaatattctagaaagcaaatcgat
gcgtacacggagtacgttaaacggtttggggctaagggcttagcttggatgaaggtcact
gacgacggctttagtggtcccgttgcgaaattcttcaagaacgatggtgactttgaagcc
attacgagtgctgctgctgctaaaccaggcgacttattattgtttgctgccgacagtttc
aaagtagtttctgacacgctgggttacttacggaccgcgattgctaaggaacttgacttg
attgatcaagatcaatacgcttacctatgggtcgttgactggccattgtttgaatatgat
gaaggcatcgagcgctgggtaccagctcaccatccattcacaatgcccaatgaagaagat
gttcattacttgaatgatggcgaagatccacacaaagcccatgcacaatcatatgatatc
atcttgaatggttatgaactcgggggcgggtcgatccggattcatacccgcgaattacaa
gaaaagatgttcaaggcattggacttcactaaggaacgagcccaagaacaatttgggttc
ttactggatgcccttgacatgggctttccgcctcatggtggcttagcaatcgggttagac
cggttcgcgatgttattatcaggtaacgacaacattcgtgaagtgatcgccttccctaag
aattccaaggcgtcagaaccaatgaccaatgcaccatcgcgggtttctgaccagcaatta
gctgatttggatttgaatattaccaatcccgtaacggatgatgaaccaaccgaataa

DBGET integrated database retrieval system