KEGG   Lactobacillus plantarum 16: Lp16_2235Help
Entry
Lp16_2235         CDS       T02698                                 

Definition
(GenBank) phosphohydrolase, HAD superfamily
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
lpz  Lactobacillus plantarum 16
Pathway
lpz00625  Chloroalkane and chloroalkene degradation
lpz01100  Metabolic pathways
lpz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lpz00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Lp16_2235
   00361 Chlorocyclohexane and chlorobenzene degradation
    Lp16_2235
Enzymes [BR:lpz01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     Lp16_2235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AGO08906
Position
complement(2381921..2382583)
Genome map
AA seq 220 aa AA seqDB search
MTKKYLTFDCYGTLINTEPLYQWVANLGLAVGLDPLTVRKAYATYEDDPASVNPYLDYST
LVRADLKHLDRLFEQRHFFESHYVECLEVQRHLLPYADVIPTLTAWQQLGYQLIIMSNSS
WDIMPANIAALKVPFTAVVTAEDVQAYKPALAFFETVQERFKLTADNHWHIARGYESDVV
PASAMQWPMIWINRDQRQPTSSERPTHMVTDLAAAKQWVN
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaaaatatttaacatttgattgttacgggacgttaattaatactgagccgctg
tatcaatgggtggctaatttaggattggcggttggtttagacccactaacggttcgcaaa
gcctacgcgacttatgaggacgatcctgccagtgtcaatccttatctagattattcaaca
ttagtccgggctgatcttaagcatttagatcgattgtttgaacagagacacttctttgaa
agtcattacgttgaatgcttggaagtgcaacgacacttattaccatacgccgatgttata
ccgaccttaacagcgtggcagcaattgggctatcaattgattattatgtcgaattcttcc
tgggatattatgccggccaacattgctgctttaaaggtgccgttcacagcggttgttacg
gctgaagacgttcaagcttacaaaccagcgttagctttctttgaaacggttcaagagcgt
tttaagttaacggcagataatcattggcatattgcacgtggctatgaatccgatgttgtt
ccagccagtgctatgcagtggccgatgatttggattaatcgtgatcagcgacaaccgact
agttctgaacggccgacccatatggttactgatttggccgctgctaagcagtgggttaac
tag

DBGET integrated database retrieval system