KEGG   Lactobacillus plantarum 16: Lp16_2819Help
Entry
Lp16_2819         CDS       T02698                                 

Definition
(GenBank) bifunctional protein: alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lpz  Lactobacillus plantarum 16
Pathway
lpz00010  Glycolysis / Gluconeogenesis
lpz00350  Tyrosine metabolism
lpz00620  Pyruvate metabolism
lpz00625  Chloroalkane and chloroalkene degradation
lpz00626  Naphthalene degradation
lpz00650  Butanoate metabolism
lpz01100  Metabolic pathways
lpz01110  Biosynthesis of secondary metabolites
lpz01120  Microbial metabolism in diverse environments
lpz01130  Biosynthesis of antibiotics
lpz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lpz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lp16_2819
   00620 Pyruvate metabolism
    Lp16_2819
   00650 Butanoate metabolism
    Lp16_2819
  Lipid metabolism
   00071 Fatty acid degradation
    Lp16_2819
  Amino acid metabolism
   00350 Tyrosine metabolism
    Lp16_2819
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Lp16_2819
   00626 Naphthalene degradation
    Lp16_2819
Enzymes [BR:lpz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Lp16_2819
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Lp16_2819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 DUF3818
Motif
Other DBs
NCBI-ProteinID: AGO09471
UniProt: R9X6E9
Position
complement(3018986..3021589)
Genome map
AA seq 867 aa AA seqDB search
MIKTEKNQTSKVTDEVDQLVQRSKKALAILKSYTQAQIDDLCEKVAVAALDNHMKLAKLA
VEETGRGVVEDKAIKNIYASEYIWNSMRHDKTVGVIKEDDEEQLMEIAEPVGIVAGVTPV
TNPTSTTVFKTLISLKGRNTIVFGFHPQAQKCSSAAADVMREAIKAAGGPADAVLYIEHP
SIEATDALMHHTDVATILATGGPSMVTAAYSSGKPALGVGPGNGPTYVEKTADIKQAVND
IVLSKTFDNGMICASENSAIIDKEIYAEVKAEFIRLGCYYVKPKDVQALSDAVIDPNRHT
VRGPVAGKTAYQIAQMAGLKDVAKDCRVLIAEINGVGIKYPLSGEKLSPVLTVYKADSHE
AAFKRANELLHYGGLGHTAGIHTTDDALVKEFGLQMPACRILVNTPSSVGGLGNIYNNMA
PSLTLGTGSYGGNSISHNVTDMDLINIKTVAKRRNNMQWVKMPPKVYFERNSVRYLEHMA
GIKKVFLVCDPGMVEFGYADRVTAVLNKRTDPVDIDIFSEVEPNPSTDTVYKGVARMKAF
KPDTIIALGGGSAMDAAKGMWLFYEHPEASFLGAKQKFLDIRKRTYKVPVSEKVTYIGIP
TTSGTGSEVTPYAVITDSKTHVKYPITDYAMQPDIAIVDPQFVETVPKRTTAWTGLDVIT
HATEAYVSTMASDFTRGWSIQALQLAFKYLKASYDGDKMAREKMHNASTLAGMAFANAFL
GINHSIAHKLGGEFNLPHGLAIAITYPQVVRYNAEIPTKLAMWPKYNHNTALADYANIAR
ALGLPGKTDEELKESLVKAYIDLAHSMDVTLSLKANRVEKKHFDATVDELAELAYEDQCT
TANPREPLISELKAIIEREWDGQGTEK
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgattaagacagaaaaaaatcaaacaagcaaagttactgacgaagttgatcaattagtt
caacgttctaagaaagcattagctattttgaagtcatatacccaagcacaaatcgatgat
ttatgtgaaaaggttgcggttgccgcactggacaatcatatgaagttagccaagttggcg
gttgaggaaaccggtcggggtgttgttgaagataaggcgattaagaacatctacgccagc
gaatatatctggaacagcatgcgccatgataagacagtcggcgtcattaaagaagacgat
gaagagcaactaatggaaattgctgaaccagttggtatcgtagccggggttacacccgta
acgaatccaacttcaacaacggttttcaagacgttgatctcattaaaggggcgtaacacg
atcgtctttggtttccatcctcaagctcagaaatgtagttctgcggctgctgatgtgatg
cgggaagcgattaaagctgctggtggtccagctgatgctgttttatacatcgaacaccca
agcattgaagcaaccgacgccttgatgcaccatacggatgttgcgacgatcttggctacc
ggtggtccaagtatggtgacagccgcttactcatcaggtaaaccagcactgggtgttggt
cctggtaacggcccaacttatgttgaaaaaacagctgacattaagcaggcggttaacgac
attgttttatcgaagacgtttgataatgggatgatttgtgcttctgaaaatagtgccatt
atcgacaaggaaatttatgctgaagttaaagctgaatttattcgtttgggttgctactac
gttaaacctaaagatgtgcaagccttgagtgatgctgtcattgatcctaaccggcacaca
gttcgtggtccagttgctggtaaaacagcttatcaaatcgcacaaatggctggcttgaaa
gatgtcgctaaggactgccgggtcttgattgcggagattaatggtgtcggtatcaagtac
ccattatccggcgaaaaattatcaccagttctgaccgtttacaaagcggattcgcatgaa
gcggcgttcaaacgggctaatgaattacttcactatggtggcttaggccatactgctggg
attcatacgaccgatgatgcattggtcaaagaatttggcttacaaatgccagcttgccgg
atcttagttaacacgccatcttcagttggtgggttaggtaacatctacaataacatggcg
ccttcattaactctgggcacgggatcatatggtggcaactcgatttctcataacgttaca
gatatggatctgattaatatcaaaactgtggcaaaacggcgtaataacatgcaatgggtc
aaaatgcctcccaaagtctacttcgaacgcaattccgttcgctacttggaacacatggcc
gggattaagaaggttttcctagtttgtgatcctgggatggttgaatttggctatgctgat
cgagtaacggcggtcttgaacaagcggactgatccggttgatatcgacatcttctcagaa
gttgaaccgaacccgtcgactgacacagtctacaaaggggttgcccggatgaaggccttt
aagccagatacaatcattgcactcggtggtggttctgcaatggacgccgctaaggggatg
tggctcttctatgaacacccagaagcttccttcttaggtgctaaacagaagttcctggat
atccggaagcggacgtacaaagtaccagtatctgaaaaagtaacttatattgggattcca
acgacttctgggactggttctgaagtaacgccatacgcggttattacggactccaagacg
cacgtcaaatacccgattacggactacgcaatgcaaccagatattgcgatcgttgaccca
caatttgttgaaacggtgccaaagcggacgacggcttggactggtctcgacgtaattacc
cacgcaaccgaagcatatgtttcaacgatggcttctgacttcacacgcggctggtcaatt
caagctttgcaattagccttcaagtacttgaaagcttcttatgatggtgacaagatggct
cgtgagaagatgcacaatgcctcaacgctagctgggatggcctttgccaatgccttcttg
ggtatcaaccactcgatcgcccataaattaggcggggaattcaacttaccacacggattg
gcaattgcgatcacgtatccgcaagtcgttcgttacaatgctgaaatcccaacgaagtta
gcaatgtggccgaagtacaaccataatactgccttagccgactatgccaacattgcccgg
gccttagggttaccaggcaagaccgacgaagaactcaaagaaagcttagttaaagcttac
attgacttggctcactcaatggatgtgaccttatccttgaaagccaaccgggtcgaaaag
aagcactttgacgccaccgtcgacgaattagccgaactggcctatgaagaccaatgcacg
accgctaacccacgcgaacctttaatcagtgaattaaaggcgattattgaacgtgaatgg
gacggccaaggtactgaaaaatag

DBGET integrated database retrieval system