KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_1185Help
Entry
LRHK_1185         CDS       T01961                                 

Definition
(GenBank) peptidase, ArgE/DapE family protein
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
lra00300  Lysine biosynthesis
lra01100  Metabolic pathways
lra01120  Microbial metabolism in diverse environments
lra01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lra00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LRHK_1185
Enzymes [BR:lra01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     LRHK_1185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M42 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AER63971
Position
complement(1122524..1123648)
Genome map
AA seq 374 aa AA seqDB search
MTDPIAFLQKLIQIDSANGNELAVARVLQAELEAADIPTKLIPYKDDRVNLVAQLNHGDR
VLGFTGHEDVVSPGDENAWTYPPFSGKIVNNTMYGRGTDDMKSGLAAMTLALIHLKQSGF
AHPLRFMATVGEEFGAMGARQLTEQGYADDLAGLVVGEPTNKLLKYAHGGTVNYEIDSEG
VSVNSSRPEKGVNAIEGLVAFATREPHAFDQAPDDPDLGPFRHSITVIKGGDQVNTIPAH
AYLRGNLRPTPAANIELVVGLLEKLVDQANKATAANLTLNVLHRFLPVHSDKNGHLVTTA
NEAIAAVTGKPAELAVAFGGTDASEFIRSDNQFDVIVYGPGDNHFSHQIDEHVDLDSYTT
AIKTYEEIAKRFFA
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcccattgcgtttttgcaaaaactaatccaaattgactctgcaaatggaaac
gaacttgcagtagcccgcgttttgcaagctgaactcgaagcggccgatattccgaccaaa
ttgatcccatacaaagatgatcgggtcaatttagttgcccagctcaatcacggtgaccgc
gtattaggcttcaccggccatgaagacgtggtgagtcccggcgatgagaacgcctggacc
tatccgcctttttccggaaagatcgtgaacaacaccatgtacggtcgcggcaccgatgat
atgaaaagtggtctagcagccatgaccttggcactgatccaccttaagcaaagcggcttt
gcccatccgctgcgtttcatggccacggtcggtgaagagtttggtgcaatgggagcgcgc
caactcaccgaacaaggttatgccgatgacttagccggactcgtggtaggcgaaccaacg
aacaaattgctaaaatacgcacacggcggaacggttaactacgaaattgacagcgaaggc
gtttccgtcaacagctcccggccggaaaaaggcgttaacgcaattgaagggttggtggca
tttgctactcgcgaaccgcacgcctttgatcaggcccctgatgatcctgacctcggtcca
ttccgccactccattaccgtgatcaaaggcggcgatcaagtcaacaccattccggcccat
gcatacttacgcggcaacttgcgcccgactcctgcagcaaatatcgaattagtcgtcggg
ttattggaaaaattagtcgatcaggcaaataaagccaccgccgctaacttgacgttgaac
gttttacatcgttttttgccggtacactctgacaaaaacgggcatctcgtgacaaccgct
aacgaagccattgccgccgtgactggtaaaccagccgagttagcggtggcttttggcgga
accgacgcgtcagaattcatccgttccgataaccagtttgacgtgattgtctatggtccc
ggcgataatcatttcagtcatcagattgacgaacatgttgatttagatagctacacgaca
gcgattaaaacttacgaagaaattgccaaacgcttttttgcctga

DBGET integrated database retrieval system