KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_1675Help
Entry
LRHK_1675         CDS       T01961                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
lra00010  Glycolysis / Gluconeogenesis
lra00052  Galactose metabolism
lra00500  Starch and sucrose metabolism
lra00520  Amino sugar and nucleotide sugar metabolism
lra00521  Streptomycin biosynthesis
lra01100  Metabolic pathways
lra01110  Biosynthesis of secondary metabolites
lra01120  Microbial metabolism in diverse environments
lra01130  Biosynthesis of antibiotics
lra01200  Carbon metabolism
Module
lra_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lra_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRHK_1675 (glcK)
   00052 Galactose metabolism
    LRHK_1675 (glcK)
   00500 Starch and sucrose metabolism
    LRHK_1675 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    LRHK_1675 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LRHK_1675 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LRHK_1675 (glcK)
Enzymes [BR:lra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LRHK_1675 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-ProteinID: AER64448
Position
complement(1628309..1629271)
Genome map
AA seq 320 aa AA seqDB search
MNDQKLIGVDLGGTTVKFAILTQGGEIQQRWSIDTNILDEGSHILPDIVTSINEHLDLYK
MTPADFVGIGMGSPGSVDSEAGTIIGAYNLNWKTLQQARKVIESGTGIPFSVDNDANVAA
LGERWKGAGENDPDVTFVTLGTGVGGGIIANGELLHGVAGSGGELGHVTVDPVNGYLCTC
GKRGCLETVASATGVVRVARDMAEEFAGDSKLKETLDDGDEISSKIVFDLAKEGDRLALM
IVDRVSFYLGLALANVGNLLNPKFIVIGGGVSAAGEFLLTRVDKYFKENTFPNVRETTSL
RLATLGNTAGVIGAASLALK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaccaaaaattgattggcgtcgacttaggcgggacgaccgtaaaatttgccatt
ttaacgcagggtggcgagattcaacaaaggtggagtattgacaccaacattttggatgaa
ggcagccatattttaccggacattgttacatctattaacgaacatctggatttatacaag
atgaccccggctgattttgtcggcattggcatgggttcgcctggatcggtggacagtgag
gcgggcacaatcatcggtgcttacaacctaaattggaaaaccttgcagcaagccagaaaa
gtaatcgaatcagggaccggcattccgtttagcgtggataatgacgccaatgttgcggcg
ttaggtgagcgctggaaaggcgccggtgaaaacgatcctgatgtcacgtttgtcacgctg
ggtaccggtgttggcggcgggattattgccaatggcgagcttttgcacggtgttgccggt
tccggtggtgagctaggccatgtcaccgttgatccggttaatggctatctttgcacctgt
ggtaaacgcggttgccttgaaacagttgccagtgcgaccggcgtagttcgggttgcacgt
gacatggcagaagaatttgccggtgactctaagttaaaagaaaccttggacgatggcgat
gagatttcgagcaaaattgttttcgacttggccaaggaaggcgatcgtctggcgttgatg
attgtggatcgggtttctttttacctcggtttggctttggccaatgtcggcaatcttttg
aatccgaaattcatcgttatcggcggcggtgtctccgcggcgggtgaattcttgctgacg
cgagtcgacaagtatttcaaagaaaacaccttcccgaatgttcgtgaaaccaccagtttg
cggttggcgacacttgggaatacagctggcgttatcggtgccgcaagcttggcattgaag
taa

DBGET integrated database retrieval system