KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_1815Help
Entry
LRHK_1815         CDS       T01961                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
lra00071  Fatty acid degradation
lra00072  Synthesis and degradation of ketone bodies
lra00280  Valine, leucine and isoleucine degradation
lra00310  Lysine degradation
lra00362  Benzoate degradation
lra00380  Tryptophan metabolism
lra00620  Pyruvate metabolism
lra00630  Glyoxylate and dicarboxylate metabolism
lra00640  Propanoate metabolism
lra00650  Butanoate metabolism
lra00900  Terpenoid backbone biosynthesis
lra01100  Metabolic pathways
lra01110  Biosynthesis of secondary metabolites
lra01120  Microbial metabolism in diverse environments
lra01130  Biosynthesis of antibiotics
lra01200  Carbon metabolism
lra01212  Fatty acid metabolism
lra02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LRHK_1815 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    LRHK_1815 (thlA)
   00640 Propanoate metabolism
    LRHK_1815 (thlA)
   00650 Butanoate metabolism
    LRHK_1815 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LRHK_1815 (thlA)
   00072 Synthesis and degradation of ketone bodies
    LRHK_1815 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LRHK_1815 (thlA)
   00310 Lysine degradation
    LRHK_1815 (thlA)
   00380 Tryptophan metabolism
    LRHK_1815 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LRHK_1815 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LRHK_1815 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LRHK_1815 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lra04147]
    LRHK_1815 (thlA)
Enzymes [BR:lra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LRHK_1815 (thlA)
Exosome [BR:lra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LRHK_1815 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AER64583
Position
complement(1763477..1764658)
Genome map
AA seq 393 aa AA seqDB search
MEKVVILSAKRTPIGKLGGELAGASAVDLGVTAAKAAIKAARLDPQQLDQAIFGNVLQAG
SGQNVARQIALHSGMATNSTAMTINEVCGSGLKAIRLGQAAIQLGEANAVLVGGTESMSQ
VPYYAEAMRAGHKFGDTALVDGLSRDGLNDAFSQQPMGITAENVASRFQISRQAQDEFAL
RSHLRAAAAAAEGRFKSQIAPVTISGRHGDVTIDTDSAIRPDTSLAQLAKLPPVFEVGGT
VTAGNASGINDGAAALILMAKSKAEQLGLHYLATITDYTEVGIDPDIMGYAPKLAIDQLM
QKTGQTLTAIDQVELNEAFASQSVAVMRDLGLTDEQVNINGGALALGHPLGASGARIMVS
LLYNLAERRQQTGIAALCVGGGIGMAMQVTLHD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagttgtgattcttagtgccaagcggacgccgattggaaagttgggcggtgag
ttagcaggtgctagtgcagtggatttaggtgttactgcagctaaggcggcgattaaagca
gcacggcttgatccgcaacaactggatcaagcaattttcgggaatgttttgcaggctgga
tcgggccagaatgttgcgcggcagattgcgttgcatagtggcatggcgacgaactccacg
gccatgacgatcaatgaagtttgcggctctgggctaaaggcaattcggttaggtcaggcg
gcgattcaactaggtgaagctaacgcggtacttgtcggcggtaccgagagtatgagtcag
gtaccgtattatgctgaggcaatgcgggccgggcataagtttggcgatactgcgttggtg
gatggtcttagtcgcgatgggctaaacgatgcttttagtcagcaaccgatggggattacg
gcggaaaatgttgccagccgctttcagatcagtcgtcaagcgcaagacgagtttgcactg
cgctctcatctgcgtgcggccgctgctgctgcagaaggccggtttaaatcacaaattgca
ccggtgaccatttccggccgacatggcgatgtcacgattgacacggattcggcgattcga
ccggatacatcattagcccagttagcaaaattaccgccagtttttgaagttggcggtacc
gtcacggcgggtaatgctagcgggattaatgacggggcggctgcattgattcttatggcg
aagtcaaaagccgagcagttaggcctccactatttggctaccatcactgactatacagaa
gtcgggattgacccggacatcatgggttatgcgcctaaattagcgattgaccagctaatg
caaaaaaccggacaaactttaacagccattgatcaagtggaattaaatgaagcattcgcc
tcgcaaagtgttgccgtgatgcgtgacttaggactgactgacgaacaggtgaatatcaat
ggcggagcgcttgctttaggccatcccttgggagcatccggcgcgcggattatggtttca
ttactgtataatctggccgaacgcaggcaacaaaccggtatcgcggcgttatgtgtcggt
ggtggtatcggtatggcgatgcaagttactttgcatgattag

DBGET integrated database retrieval system