KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_189Help
Entry
LRHK_189          CDS       T01961                                 

Definition
(GenBank) ketose-bisphosphate aldolases family protein
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
lra00010  Glycolysis / Gluconeogenesis
lra00030  Pentose phosphate pathway
lra00051  Fructose and mannose metabolism
lra00680  Methane metabolism
lra01100  Metabolic pathways
lra01110  Biosynthesis of secondary metabolites
lra01120  Microbial metabolism in diverse environments
lra01130  Biosynthesis of antibiotics
lra01200  Carbon metabolism
lra01230  Biosynthesis of amino acids
Module
lra_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lra_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRHK_189
   00030 Pentose phosphate pathway
    LRHK_189
   00051 Fructose and mannose metabolism
    LRHK_189
  09102 Energy metabolism
   00680 Methane metabolism
    LRHK_189
Enzymes [BR:lra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     LRHK_189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase SepSecS
Motif
Other DBs
NCBI-ProteinID: AER63044
Position
195083..195952
Genome map
AA seq 289 aa AA seqDB search
MVLVNTKEMIKKAKEGHYAVGSFNVTDIEMIRGIVGAAEKENSPVIIQFAELHDKYVPLD
VIAPVMLNVARKASVPVAVHFDHGETFDNIMRAIRLGFTSVMVDASQENFADNLAQTKEI
VKICKPLNISVEAELGPMNREGSGDKKVDYADLNKTYTNPQEAKQFIEESGIDMLAVAYG
TVHGVYTQKPHLSFSRLKEISDLVDFPLVVHGASGLTDEEYRKSVENGICKINYYSEMVH
RVALGVQKKLEQDDSDKQLFISDASIWETEMVEEEIRGRLRVFGSAGKA
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggttttagttaatacaaaagaaatgattaaaaaggctaaggaaggccattatgcagtt
ggttcatttaacgtgacggacattgaaatgattcgcggaatcgttggtgcagcggagaag
gaaaactcaccggtgattatccagtttgctgaattacatgataagtatgtaccactggat
gtgattgctccggttatgctaaatgttgcgcgcaaggcttcagttcccgttgcagttcat
tttgatcacggggaaacctttgataacatcatgcgagccattcgattaggcttcacttcg
gttatggttgacgcgtcacaggaaaattttgctgataatctggcccaaactaaagaaatt
gtcaaaatttgcaagcctctgaacatttcggttgaagccgagcttggaccaatgaatcgt
gaaggcagtggcgataagaaagttgattatgccgatctaaataagacgtatacgaaccct
caagaagccaagcaattcattgaagagtccggcattgatatgttggcggttgcatatgga
acggttcatggggtttatacccagaagccgcacttaagtttcagtcggttaaaggaaatt
tctgatttggttgacttcccactcgtcgttcacggcgcttctggattgacagatgaagaa
tatcgtaagtcggttgaaaatggtatttgcaagatcaattactattcggaaatggttcat
cgagttgcgttgggtgttcaaaagaaattagaacaagatgatagtgataaacaactattt
atttcggacgctagcatttgggaaaccgaaatggtcgaagaagaaattcgcgggcgacta
cgggtcttcggttcggcaggtaaggcttaa

DBGET integrated database retrieval system