KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_1898Help
Entry
LRHK_1898         CDS       T01961                                 

Definition
(GenBank) conserved carboxylase domain protein
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
lra00620  Pyruvate metabolism
lra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LRHK_1898
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lra02000]
    LRHK_1898
Enzymes [BR:lra01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     LRHK_1898
Transporters [BR:lra02000]
 Other transporters
  Primary active transporters [TC:3]
   LRHK_1898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA AtuA
Motif
Other DBs
NCBI-ProteinID: AER64652
Position
complement(1844047..1845450)
Genome map
AA seq 467 aa AA seqDB search
MAKQKVQFMETVLRDGQQSLIATRMPSSDILPILDKMDAAGYHALEMWGGATFDACLRYL
NEDPWERLRKIRQAVKHTKLQMLLRGQNLLGYKNYADDVVADFVTKSVENGIDIIRIFDA
LNDTRNLKTALEATKQAGGHAQLAISYTTSDFHTIDYFIKLAKEMADMGADSIAIKDMAG
ILTPQKAFDLVSGIKQEITVPLEVHTHATAGMAEMTYLEAVRAGADIIDTAVSPFAGGTS
QPATESMLVALQDLGYPTDVKLAEVSDIASYFAPIRDQFRDAGQLNPRVKDVEPKSLIYQ
VPGGMLSNLLAQLKDQGQEALYGDVLKEVPRVRADLGYPPLVTPLSQMVGTQSLMNVMSG
ERYKLIPKEIKDYVRGLYGRPPVPISPEMKKKIIGDAPVITTRPADLIEPQLPTFRKAIA
EYAHSEEDVLSYALFPDQAKDFLGRREDPFYDVPVQKVSLTFDPTHN
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacaaaaagtccaattcatggaaacagttttgcgtgatggtcagcaaagcctg
atcgctacccggatgccatcaagcgatattttgccaattttggataaaatggatgcggcc
ggctaccacgcattggagatgtggggtggcgctacgtttgatgcttgcttgcgttattta
aacgaagacccgtgggagcgactgcggaaaattcgtcaagccgtcaagcacactaagttg
cagatgttgctgcgtggccaaaacttgcttggttataagaactatgctgatgatgtcgtc
gccgattttgtcacgaaatcagttgaaaacggtattgacatcattcgtatttttgatgcg
ttaaatgatacacgtaatttgaaaaccgcactggaagctaccaagcaagcgggtggccac
gcacagctggcgattagttataccaccagtgatttccatacgattgactatttcatcaag
ctggcaaaagaaatggcagacatgggcgctgactccattgccattaaagacatggccggc
attttaaccccgcagaaagcctttgatcttgtaagcggcattaagcaggaaattacggtt
ccgctagaggtccatacgcatgcgactgcgggaatggctgaaatgacgtatcttgaggca
gtgcgcgcaggtgctgatattattgatacggcggtttccccatttgctggcggtaccagt
cagccggcaaccgaatcaatgctcgtagctttgcaggacttaggctacccgactgatgtc
aaactagccgaagtcagtgacattgccagctattttgcaccgattcgcgatcaattccgt
gatgccgggcagctaaatccccgcgttaaagatgttgaaccaaagtcactgatttaccaa
gtgccaggcgggatgctttctaacttgttggcgcaattgaaagatcaggggcaagaggcc
ttatatggggatgttttaaaagaagtgccccgcgttcgggctgacttgggttatccgccg
ttggttaccccattgtcacaaatggttggtacgcaaagcttgatgaatgtgatgagcgga
gagcggtataagctgatccctaaagaaatcaaagactatgttcgcggactttatggtcgg
ccgcctgtgccaatttcccctgagatgaaaaagaaaattattggtgacgcgccggttatc
accacgcgaccggcagacctgattgagccgcaactaccgacatttcgtaaagctattgcc
gaatatgcccattcagaagaagatgtcttgagttatgcgctcttccctgatcaggcaaaa
gactttttaggccggcgtgaagatccgttttatgatgtgccggttcaaaaagtttcactg
acatttgatcctactcataattaa

DBGET integrated database retrieval system