KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_233Help
Entry
LRHK_233          CDS       T01961                                 

Definition
(GenBank) HAD hydrolase, IA, variant 1 family protein
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
lra00361  Chlorocyclohexane and chlorobenzene degradation
lra00625  Chloroalkane and chloroalkene degradation
lra01100  Metabolic pathways
lra01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lra00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LRHK_233
   00361 Chlorocyclohexane and chlorobenzene degradation
    LRHK_233
Enzymes [BR:lra01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     LRHK_233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 HAD Hydrolase_6 5_nucleotid
Motif
Other DBs
NCBI-ProteinID: AER63088
Position
complement(228796..229452)
Genome map
AA seq 218 aa AA seqDB search
MDITFDCYGTLLDTRPIRTQFMTFSARHGIDGQAAWHQFESWEDRLMYGETTLPFTTLLK
RDLQYLDMTFRTNSLFSHYFHDLFESYINLQPWPEVIPALQQLRQAGHRIIIMSNSTPDL
MTHHFDQLEHQVDQAILPEQTHCYKPTLSFFTTAETRLNQPHLHVAMGYWWDIVPCHKLG
WPCVWINRQQLSPLPDITPTYSLPNLTELPALVEKIAS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggatattacatttgactgctatggtactttgctagacacccgccccattcgaacccag
tttatgaccttcagtgctcgtcatggtattgacggtcaggctgcatggcaccaattcgaa
tcgtgggaggatcgcctcatgtatggcgagaccaccttgcctttcaccaccttattgaag
cgcgatctgcaatatcttgatatgacttttcgcaccaattcactatttagccattatttt
catgatttatttgagtcctatattaacttacaaccatggccagaagtcatccccgctttg
cagcaattgcgccaagccggtcatcgaatcatcatcatgtccaattccaccccggattta
atgacccaccactttgaccagctggagcaccaagttgatcaagccattttaccggagcaa
acgcattgttataaaccaactttgtccttttttaccacggccgaaacccgactcaaccaa
ccccatctccacgtggcaatggggtattggtgggatatcgtaccctgtcataaactcggc
tggccttgcgtatggattaatcgccagcaattatcaccactaccagacataacgccgact
tattccctgccaaatctgacagaactacccgcgttggtcgaaaaaattgcttcttga

DBGET integrated database retrieval system