KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_2493Help
Entry
LRHK_2493         CDS       T01961                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
lra03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lra00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LRHK_2493 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lra03011]
    LRHK_2493 (rplV)
Ribosome [BR:lra03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LRHK_2493 (rplV)
  Bacteria
    LRHK_2493 (rplV)
  Archaea
    LRHK_2493 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AER65234
Position
complement(2430678..2431031)
Genome map
AA seq 117 aa AA seqDB search
MADQITSATATAKTVRIAARKARLVIDLIRGRDVAEALAILEFTPRSGSPIIEKVLKSAI
ANAEHNYDLDAQNLYVSKAYVNEGPTLKRFRPRAKGSASPINKRTSHVTVVVSEKEA
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggctgatcaaattacgtctgcaacggcaacggccaagacggttcggattgctgctcgc
aaagcgcgcttggtaatcgacttgattcgtggtcgcgatgttgctgaagcactggcgatt
cttgagttcacacctcgttccggttctccgatcatcgaaaaggtactcaagtctgctatt
gctaatgcagaacataactatgacttagatgcacaaaacctttatgtaagcaaagcttat
gtcaacgaaggcccgaccctcaaacggttccgtcctcgtgctaaggggagcgcatcaccg
atcaataaacggacaagccacgttaccgtggttgtatccgaaaaagaagcataa

DBGET integrated database retrieval system