KEGG   Lactobacillus rhamnosus ATCC 8530: LRHK_422Help
Entry
LRHK_422          CDS       T01961                                 

Gene name
sorB
Definition
(GenBank) sorbose-specific phosphotransferase enzyme IIB component
  KO
K02813  sorbose PTS system EIIB component [EC:2.7.1.206]
Organism
lra  Lactobacillus rhamnosus ATCC 8530
Pathway
lra00051  Fructose and mannose metabolism
lra01100  Metabolic pathways
lra02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:lra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LRHK_422 (sorB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    LRHK_422 (sorB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lra02000]
    LRHK_422 (sorB)
Enzymes [BR:lra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     LRHK_422 (sorB)
Transporters [BR:lra02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    LRHK_422 (sorB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: AER63269
Position
411539..412033
Genome map
AA seq 164 aa AA seqDB search
MIITLARVDDRLIHGQVTTVWSKESNADRIIIVSSEVYKDDIRKTLLKQAAPPGMKVNIV
DVPKAIAVYNNPKYSKDKVFYLFTNPSEVVDLVKGGIPLKKLNIGGMQFKQGKTQISKAV
SLNAEDVAAFRELDRLGVKLDLRVVKTDPSTDILTKIDETFGKD
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgattattacgcttgcaagagttgacgatcgcttaattcatggtcaggttacaacagtc
tggtctaaagaatcaaatgcggatcgtatcatcatcgtcagttcagaggtttataaggac
gatattcgtaagaccttgttaaagcaggcagcacctccaggcatgaaagtcaatattgtt
gatgtaccaaaggcgattgctgtttataacaatcccaaatatagcaaagataaagtgttc
tatttgtttaccaatccaagtgaagtagttgatctggtaaaaggtggaattccattaaag
aaattaaacattggtggaatgcaatttaagcaaggtaagacccagattagtaaggctgtt
tccttaaatgcagaagatgttgcagcatttcgagaattagatcgattaggagtcaagctt
gatctccgtgtagttaaaacagatccatctacagatattttgactaagatagatgaaacg
tttggaaaggattag

DBGET integrated database retrieval system