KEGG   Lactobacillus rhamnosus LOCK908: LOCK908_0136Help
Entry
LOCK908_0136      CDS       T02731                                 

Definition
(GenBank) Adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
lrc  Lactobacillus rhamnosus LOCK908
Pathway
lrc00230  Purine metabolism
lrc00250  Alanine, aspartate and glutamate metabolism
lrc01100  Metabolic pathways
Module
lrc_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:lrc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LOCK908_0136
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LOCK908_0136
Enzymes [BR:lrc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     LOCK908_0136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AGP72823
Position
151319..152611
Genome map
AA seq 430 aa AA seqDB search
MGTVVIVGTQWGDEGKGKITDFLSQGAKVVSRYQGGDNAGHTIHANGQVYKLRLIPSGVL
YPHQLSVIGNGVVVNPKSLVGELARLAEQGVTGENLRISDRAHVILPYHIKLDKLQEEAK
GADKIGTTNRGIGPAYMDKAARVGIRMADLLDKDIFAERLKANLKAKNEEFVKVYNSTPM
TFDEIFEEYYNYGQQLKQYVCDTSIVLNDAIDQGEHVLFEGAQGIMLDIDQGTYPFVTSS
NPAGGVTVGAGVGASKIDRVVGVAKAYTSRVGDGPFPTELLDKTGDFIRNAGHEFGTVTG
RPRRIGWFDAVVVRHSRRVAGITDLCLNSIDVLTGLDTVKICVAYERDGERIENYPASLK
FLSECKPVYEELPGWKEDITHAKTLADLPENARHYVERITELLGVDLLTFSVGPDRDQTN
VIANVWDKVK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgggaactgtagttattgtcggcacacaatggggcgacgaaggtaaaggaaagattact
gatttcttgagccaaggcgccaaggtggttagccgttatcaaggcggtgacaatgcaggc
cataccattcatgccaatggtcaagtctataaattacgcttgattccgtctggtgttctt
tatccgcatcagttatccgtcatcggtaatggcgttgtggtcaaccctaagagcttagtc
ggcgaactggctcgacttgccgaacaaggggtaactggtgaaaatctacgaatctcagat
cgcgcccacgttattttgccttaccacattaaactcgataaattacaagaagaagcaaaa
ggtgccgataagatcgggacgacgaatcgcggcatcggtccggcctatatggacaaagct
gcccgggtcggcattcgaatggcggaccttttggataaggatatcttcgcagaacggctg
aaggcaaacctgaaagctaagaacgaagaattcgtcaaggtctataacagcacgccaatg
acgtttgatgaaatttttgaagaatattacaactacggccaacagttgaaacaatatgtc
tgcgatacctcgattgtgttaaatgacgcgattgatcaaggtgagcatgtgttgtttgaa
ggcgctcaagggatcatgctggacattgatcaaggaacgtatccgtttgtcacctcatcg
aacccagctggcggtgtcacggtcggtgctggcgttggggcctccaagattgatcgcgtg
gtcggcgttgccaaggcatacacgtcgcgtgttggcgatggcccattcccgacagaattg
cttgataaaaccggcgacttcatccggaatgctgggcatgaatttgggaccgttaccggc
cggccgcggcgaatcggttggtttgacgcggtggttgtgcgccattcacgccgcgttgcc
gggattaccgacttgtgcctcaactcaattgacgtgctaaccggtttggacactgttaag
atctgcgtcgcttatgagcgtgacggtgaacggattgaaaattatccggcatcgctgaag
ttcctgagtgaatgcaagccggtttacgaagaattgccgggctggaaggaagacatcacc
catgccaagacactagccgatttgccagaaaacgcacggcattatgttgagcgcatcacc
gagctgctcggagtggatcttttgaccttctctgttggtccggatcgtgatcaaaccaac
gtaattgcgaacgtgtgggataaagtgaagtaa

DBGET integrated database retrieval system