KEGG   Lactobacillus rhamnosus LOCK908: LOCK908_1876Help
Entry
LOCK908_1876      CDS       T02731                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase/Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lrc  Lactobacillus rhamnosus LOCK908
Pathway
lrc00071  Fatty acid degradation
lrc00072  Synthesis and degradation of ketone bodies
lrc00280  Valine, leucine and isoleucine degradation
lrc00310  Lysine degradation
lrc00362  Benzoate degradation
lrc00380  Tryptophan metabolism
lrc00620  Pyruvate metabolism
lrc00630  Glyoxylate and dicarboxylate metabolism
lrc00640  Propanoate metabolism
lrc00650  Butanoate metabolism
lrc00900  Terpenoid backbone biosynthesis
lrc01100  Metabolic pathways
lrc01110  Biosynthesis of secondary metabolites
lrc01120  Microbial metabolism in diverse environments
lrc01130  Biosynthesis of antibiotics
lrc01200  Carbon metabolism
lrc01212  Fatty acid metabolism
lrc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lrc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LOCK908_1876
   00630 Glyoxylate and dicarboxylate metabolism
    LOCK908_1876
   00640 Propanoate metabolism
    LOCK908_1876
   00650 Butanoate metabolism
    LOCK908_1876
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LOCK908_1876
   00072 Synthesis and degradation of ketone bodies
    LOCK908_1876
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LOCK908_1876
   00310 Lysine degradation
    LOCK908_1876
   00380 Tryptophan metabolism
    LOCK908_1876
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LOCK908_1876
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LOCK908_1876
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LOCK908_1876
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lrc04147]
    LOCK908_1876
Enzymes [BR:lrc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LOCK908_1876
Exosome [BR:lrc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LOCK908_1876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGP74511
Position
complement(1839961..1841142)
Genome map
AA seq 393 aa AA seqDB search
MEKVVILSAKRTPIGKLGGELAGASAVDLGVTAAKAAIKAARLDPQQLDQAIFGNVLQAG
SGQNVARQIALHSGMATNSTAMTINEVCGSGLKAIRLGQAAIQLGEANAVLVGGTESMSQ
VPYYAEAMRAGHKFGDTALVDGLSRDGLNDAFSQQPMGITAENVASRFQISRQAQDEFAL
RSHLRAAAAAAEGRFKSQIAPVTISGRHGDVTIDTDSAIRPDTSLAQLAKLPPVFEVGGT
VTAGNASGINDGAAALILMAKSKAEQLGLHYLATITDYTEVGIDPDIMGYAPKLAIDQLM
QKTGQTLTAIDQVELNEAFASQSVAVMRDLGLTDEQVNINGGALALGHPLGASGARIMVS
LLYNLAERRQQTGIAALCVGGGIGMAMQVTLHD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagttgtgattcttagtgccaagcggacgccgattggaaagttgggcggtgag
ttagcaggtgctagtgcagtggatttaggtgttactgcagctaaggcggcgattaaagca
gcacggcttgatccgcaacaactggatcaagcaattttcgggaatgttttgcaggctgga
tcgggccagaatgttgcgcggcagattgcgttgcatagtggcatggcgacgaactccacg
gccatgacgatcaatgaagtttgcggctctgggctaaaggcaattcggttaggtcaggcg
gcgattcaactaggtgaagctaacgcggtacttgtcggcggtaccgagagtatgagtcag
gtaccgtattatgctgaggcaatgcgggccgggcataagtttggcgatactgcgttggtg
gatggtcttagtcgcgatgggctaaacgatgcttttagtcagcaaccgatggggattacg
gcggaaaatgttgccagccgctttcagatcagtcgtcaagcgcaagacgagtttgcactg
cgctctcatctgcgtgcggccgctgctgctgcagaaggccggtttaaatcacaaattgca
ccggtgaccatttccggccgacatggcgatgtcacgattgacacggattcggcgattcga
ccggatacatcattagcccagttagcaaaattaccgccagtttttgaagttggcggtacc
gtcacggcgggtaatgctagcgggattaatgacggggcggctgcattgattcttatggcg
aagtcaaaagccgagcagttaggcctccactatttggctaccatcactgactatacagaa
gtcgggattgacccggacatcatgggttatgcgcctaaattagcgattgaccagctaatg
caaaaaaccggacaaactttaacagccattgatcaagtggaattaaatgaagcattcgcc
tcgcaaagtgttgccgtgatgcgtgacttaggactgactgacgaacaggtgaatatcaat
ggcggagcgcttgctttaggccatcccttgggagcatccggcgcgcggattatggtttca
ttactgtataatctggccgaacgcaggcaacaaaccggtatcgcggcgttatgtgtcggt
ggtggtatcggtatggcgatgcaagttactttgcatgattag

DBGET integrated database retrieval system