KEGG   Lactobacillus rhamnosus LOCK908: LOCK908_2551Help
Entry
LOCK908_2551      CDS       T02731                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lrc  Lactobacillus rhamnosus LOCK908
Pathway
lrc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lrc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LOCK908_2551
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lrc03011]
    LOCK908_2551
Ribosome [BR:lrc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LOCK908_2551
  Bacteria
    LOCK908_2551
  Archaea
    LOCK908_2551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGP75171
Position
complement(2529069..2529422)
Genome map
AA seq 117 aa AA seqDB search
MADQITSATATAKTVRIAARKARLVIDLIRGRDVAEALAILEFTPRSGSPIIEKVLKSAI
ANAEHNYDLDAQNLYVSKAYVNEGPTLKRFRPRAKGSASPINKRTSHVTVVVSEKEA
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggctgatcaaattacgtctgcaacggcaacggccaagacggttcggattgctgctcgc
aaagcgcgcttggtaatcgacttgattcgtggtcgcgatgttgctgaagcactggcgatt
cttgagttcacacctcgttccggttctccgatcatcgaaaaggtactcaagtctgctatt
gctaatgcagaacataactatgacttagatgcacaaaacctttatgtaagcaaagcttat
gtcaacgaaggcccgaccctcaaacggttccgtcctcgtgctaaggggagcgcatcaccg
atcaataaacggacaagccacgttaccgtggttgtatccgaaaaagaagcataa

DBGET integrated database retrieval system