KEGG   Lactobacillus reuteri DSM 20016: Lreu_0052Help
Entry
Lreu_0052         CDS       T00535                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
lre00071  Fatty acid degradation
lre00072  Synthesis and degradation of ketone bodies
lre00280  Valine, leucine and isoleucine degradation
lre00310  Lysine degradation
lre00362  Benzoate degradation
lre00620  Pyruvate metabolism
lre00630  Glyoxylate and dicarboxylate metabolism
lre00640  Propanoate metabolism
lre00650  Butanoate metabolism
lre00900  Terpenoid backbone biosynthesis
lre01100  Metabolic pathways
lre01110  Biosynthesis of secondary metabolites
lre01120  Microbial metabolism in diverse environments
lre01130  Biosynthesis of antibiotics
lre01200  Carbon metabolism
lre01212  Fatty acid metabolism
lre02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Lreu_0052
   00630 Glyoxylate and dicarboxylate metabolism
    Lreu_0052
   00640 Propanoate metabolism
    Lreu_0052
   00650 Butanoate metabolism
    Lreu_0052
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Lreu_0052
   00072 Synthesis and degradation of ketone bodies
    Lreu_0052
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Lreu_0052
   00310 Lysine degradation
    Lreu_0052
   00380 Tryptophan metabolism
    Lreu_0052
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Lreu_0052
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Lreu_0052
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Lreu_0052
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lre04147]
    Lreu_0052
Enzymes [BR:lre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Lreu_0052
Exosome [BR:lre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Lreu_0052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C SpoVAD ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABQ82328
UniProt: A5VHK4
Position
65035..66213
Genome map
AA seq 392 aa AA seqDB search
MEKVYIVAAQRTPIGKFNGQLASKSAVELGAIAIKAAVEKAKLSENDIDQVLMGNVIQAG
TGQNPARQASMAAGLGEQVPAITINDVCASGMSSVDLAASLIRAGQANVIVAGGMESMSQ
APYVLPKARNGYRFGNGTLLDAMQSDALNDVYGGYPMGITAENINDKYQITRHQQDEFAL
MSHQRAVKAQKAGYFDSEIVPVEVKQKRTTVTVTVDEAPRPDTSLAALAKLKPAFKSDGS
VTAGNASGINDGGAALVLASESAVNRLGLTPLAEWQGSAVVGLDPALMGLGPYYAIKKLL
KNQQLSADDVDTYEINEAFATQALVCQNLLHLDPRAVNPWGGAIALGHPVGCSGARIIVT
MISEMHRDNHELGIASLCVGGGMGEAVLLKKI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggtttacattgttgctgctcagcgaacaccaatcggtaagtttaacggtcag
ttagcttcaaagtctgcagttgaattaggagcgattgcaattaaagcggctgttgaaaag
gcaaagctcagcgaaaacgatattgaccaagtgttaatggggaatgttattcaagcagga
acgggacaaaatccagcgcgtcaagcatcaatggccgctggattaggtgagcaggttccg
gcaataacgattaatgacgtctgtgcgtcgggaatgtccagtgttgacctggcagcaagt
ttgattcgcgcaggacaggctaatgtaattgttgccggggggatggaaagtatgtcccaa
gctccatatgttcttcctaaggcacggaatggctatcgatttgggaatggaaccttgctt
gatgcgatgcaaagtgatgcattaaatgatgtttatggcggttatccgatgggaattact
gctgaaaatatcaatgataagtatcagattactcgtcaccaacaagacgaatttgctttg
atgagccaccaacgtgcggtaaaggctcaaaaagcaggctatttcgattcagaaattgta
ccagttgaagttaagcagaaacgaacaacagtgactgtaactgttgacgaagctccacga
ccagatacttcactagcggctttagcaaaattaaaaccagcttttaaatctgacggaagt
gtgactgcagggaatgcctcgggaattaatgatggtggagctgccttggttcttgcttct
gaaagtgcagtcaaccgattaggattaactccattggctgagtggcaaggatctgcagtt
gttggtcttgatccagcattgatgggtttgggaccatattatgcaatcaagaagctctta
aaaaatcagcagctgtcggcagatgacgtagatacttacgaaattaatgaggcgtttgcg
acccaagcccttgtctgtcagaacttgcttcatcttgatcctagggctgtcaatccttgg
ggtggggcaattgcattaggccatcctgttgggtgttcaggagcacgaattatcgtcacg
atgattagtgaaatgcatagggataatcatgaactcggcattgcttcgctgtgtgtcggg
ggcggaatgggtgaagcggttctgcttaagaaaatttag

DBGET integrated database retrieval system