KEGG   Lactobacillus reuteri DSM 20016: Lreu_0910Help
Entry
Lreu_0910         CDS       T00535                                 

Definition
(GenBank) glycoside hydrolase, clan GH-D
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
lre00052  Galactose metabolism
lre00561  Glycerolipid metabolism
lre00600  Sphingolipid metabolism
lre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lre00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Lreu_0910
  Lipid metabolism
   00561 Glycerolipid metabolism
    Lreu_0910
   00600 Sphingolipid metabolism
    Lreu_0910
Enzymes [BR:lre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Lreu_0910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Melibiase_2 GHL10
Motif
Other DBs
NCBI-ProteinID: ABQ83172
UniProt: A5VJZ8
Position
964993..967182
Genome map
AA seq 729 aa AA seqDB search
MITFDEQQRVFHLKNKEISYLFSVEEGNILSHLYFGPAIRNYHGERRYPRVDRGFSGNLP
GSMDRTYSKDDLLQEYSGNNTGDYRVPAIIIKTENGSRLTDFRYKSYKILPGKPKLAGLP
ASYVKSDKEAETLEVILVDETIGAQLILSYTIYNERPVITRNARLVNTSNQELRIEKIAS
MQLDLTKHDYDVISVPGQYALERQPERQELRRGITEFSSRRNSSSHHMNPFVALVDKNTD
EFQGNALGVLLVYSGNHQFTLEKDQIDQIRLITGINDYDFEWVLEPGKDFQTPEAIMGFS
QQGLNGMSQVFHKLLRDRVARGKYQYADRPIVINNWEATFFDFDDKKLDQIIDEAKPLGI
EMFVLDDGWFGHRNDDNSSLGDWFVNQDKLTGGLKRVADRTHEHGMKFGLWFEPEMISVD
SKLYKEHPDYALHEPNRGMTLSRNQLVLDFSRKEVVDNIYNQMCLILDKVLLDYIKWDFN
RNLTEVFSSAADADHQGEISHRYVLGLYDLMERLVTRYPNILFEGCSGGGGRFDAGILYY
MPQSWPSDDTDAVERLKIQYGTSLTYPISSMTAHVSVSPNQQTGRSTSFKMRGDVAMSGV
FGYELDLADLTEEDRQMVKEQIKFYKAHRHLIQYGAFIRLESPFDSNTVAWEFVSPDKSE
ALLFMFKQLHTNRFEINNTKMAGLDPTIDYHDEMTDKTYGGDELMNVGLFRDPTHTGDFI
SEVHYFKGE
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgattacatttgatgaacagcaacgtgtttttcacttaaaaaataaagaaatttcctat
ttattttcagtagaagagggaaatatcctcagtcacctttattttggaccggcaattcgc
aactaccatggtgaacgtcgatatccacgagttgatcgtggattttcagggaaccttcct
gggtcgatggaccgaacttactctaaagatgatttgttgcaggagtattcaggaaacaat
accggagactatcgcgtgcctgcgattattatcaaaacagaaaatggttcacgactgact
gatttccgttacaagtcttataagattttaccggggaagcccaaactagctgggttacct
gcatcttatgttaaaagtgataaagaagcagaaacgttggaagttattttggttgatgaa
acaattggtgcgcaacttattctttcgtacactatctataacgaacggccggttattaca
aggaatgcgcggttagtaaacacaagcaatcaagaattacgaattgaaaagattgcctca
atgcaactagatttaactaaacatgattatgacgttatctccgttccaggccagtatgcc
cttgaacgacaacctgaacggcaagaattacgtcggggaataacagaattttctagccgt
cgaaattctagttctcatcatatgaacccgtttgtggccttggttgataagaataccgat
gaatttcaaggaaacgctttgggagtgctccttgtttactctggtaatcaccagtttacc
ttggaaaaagatcagattgaccagattcgcttaataaccggaattaatgattatgacttt
gaatgggttcttgaaccgggaaaagattttcagacaccggaagcaatcatgggctttagt
cagcagggcctaaatgggatgtcacaagtattccacaagttattacgggaccgggttgct
cgcggtaagtatcaatatgcagaccgcccaattgttattaataattgggaagcgaccttc
tttgactttgatgataagaagttagaccaaattattgatgaagcaaagccattgggaatt
gaaatgtttgttcttgatgacggctggtttggccaccggaatgatgataattcatcgctt
ggtgattggtttgttaaccaggataagcttactggtggattaaagcgggtagcagaccgg
acccacgagcatggcatgaaattcggcctctggtttgagccagaaatgatttcagtcgat
tctaagttatataaggaacatccagactatgccttacatgaaccgaaccgtggcatgaca
ctttctcgtaatcaattagtactagactttagccgtaaagaagtcgttgataatatttac
aatcaaatgtgcttaattttagataaggtgctgcttgactatattaaatgggacttcaac
cgtaatcttactgaagtcttctctagcgcagcggatgcagaccatcaaggagaaattagc
caccgttatgttttaggtttatatgacttaatggagcggttagttacccgttatcctaat
attttgtttgaaggctgctctggcggtggtggccgctttgatgctggtattctttactac
atgccgcaaagttggccatcagatgatacagacgcggtcgaacggttaaagatccaatac
ggaacatctttaacttatccaatctcatctatgacggcgcatgtatcagtttcacctaac
cagcaaactggtcgttctactagttttaagatgcggggcgatgttgccatgagcggggtc
tttggctatgaacttgacttagcagatttgactgaagaggatcggcaaatggtaaaggaa
cagatcaagttctacaaggctcaccgccacttaattcaatatggtgcctttattcgctta
gaaagtccttttgatagcaatacagtcgcttgggaatttgtcagtcctgataagtcagaa
gcgctgctatttatgtttaagcagttgcatactaaccgttttgaaattaataataccaag
atggcgggacttgatccaacaattgattatcatgatgagatgaccgataagacttatggt
ggggatgaattgatgaatgtcggtttgttccgtgacccgactcatacgggggacttcatt
tccgaagtgcattactttaaaggtgaatag

DBGET integrated database retrieval system