KEGG   Lactobacillus reuteri DSM 20016: Lreu_1478Help
Entry
Lreu_1478         CDS       T00535                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
lre03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lre00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Lreu_1478
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lre03011]
    Lreu_1478
Ribosome [BR:lre03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Lreu_1478
  Bacteria
    Lreu_1478
  Archaea
    Lreu_1478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ABQ83724
UniProt: A5VLK0
Position
complement(1526455..1526802)
Genome map
AA seq 115 aa AA seqDB search
MAENITSAKATAKMVRVSARKVRLVLDAIRGKSVAEAFAILKFTPRGAASDVEKVLKSAV
ANAENNFDLDRASLVVSEAFANEGPTLKRFRPRAKGSASPINKRTSHITVVVTER
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaacattacgtcagctaaggctactgccaagatggtacgggtttctgctcgt
aaggttcgtcttgtattagatgccattcgtggcaagagtgttgccgaagcatttgctatt
ttgaagttcacccctcgtggtgccgcttcagatgttgaaaaagtattaaaatctgctgtt
gcaaacgctgaaaacaatttcgacttagatcgcgcttcattggttgtaagtgaagccttt
gctaacgaaggaccaactcttaaacggttccgtcctcgcgctaagggttctgcttctcca
attaacaagcggactagtcatattacagtggttgttacagaacgatag

DBGET integrated database retrieval system