KEGG   Lactobacillus reuteri DSM 20016: Lreu_1589Help
Entry
Lreu_1589         CDS       T00535                                 

Definition
(GenBank) Alcohol dehydrogenase, zinc-binding domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
lre  Lactobacillus reuteri DSM 20016
Pathway
lre00010  Glycolysis / Gluconeogenesis
lre00071  Fatty acid degradation
lre00350  Tyrosine metabolism
lre00625  Chloroalkane and chloroalkene degradation
lre00626  Naphthalene degradation
lre01100  Metabolic pathways
lre01110  Biosynthesis of secondary metabolites
lre01120  Microbial metabolism in diverse environments
lre01130  Biosynthesis of antibiotics
lre01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lre00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lreu_1589
  Lipid metabolism
   00071 Fatty acid degradation
    Lreu_1589
  Amino acid metabolism
   00350 Tyrosine metabolism
    Lreu_1589
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Lreu_1589
   00626 Naphthalene degradation
    Lreu_1589
Enzymes [BR:lre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Lreu_1589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C ACP_syn_III PALP
Motif
Other DBs
NCBI-ProteinID: ABQ83830
UniProt: A5VLV6
Position
complement(1645286..1646341)
Genome map
AA seq 351 aa AA seqDB search
MKKAIFEKAGQMKIVDVDRPTIEKPDDVIIKVVRTCVCGSDLWNFRGINPVEKDSENSGH
EAIGIVEEVGEDITTVKPGDFVIAPFTHGCGHCAACRAGFDGSCQSHNDNFSSGVQAQYV
RFQHGQWALVKVPGKPSDYSEGMLKSLLTLADVMATGYHAARVANVSDGDTVVVMGDGAV
GLCAIIAAKMRGAKKIISTSRHADRQALAKEFGATDNVAERSDEAVQKIMELTNGAGADA
VLECVGTEQSTDTAMKVGRPGTIVGRVGLPHTPKMDMTVLFYNNTIVGGGPASVTTYDKD
VLLKAVLDGDINPGKVFTKSFDLDQIQEAYEAMDKREAIKSYIIMDGFERD
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagctatttttgaaaaggcgggtcaaatgaagattgttgatgttgaccgtcca
acaattgaaaagcctgatgacgtaattattaaggtagtgcggacctgtgtttgtggttct
gacctatggaacttccgaggaattaatccggttgaaaaagattctgaaaactctggccat
gaagcaattggaattgttgaagaagttggtgaagatatcactactgtcaaacctggggac
tttgtgattgctccatttactcatggatgtgggcactgtgctgcttgtcgcgcgggcttc
gatggttcttgccaaagtcacaacgataactttagctctggtgtgcaagctcaatacgtt
cggttccaacacggtcaatgggcgcttgttaaagttccgggcaagccaagtgactacagt
gaaggaatgcttaagtccctcttaacccttgctgatgttatggctactggttaccacgct
gcacgagttgctaacgttagtgatggtgatacagttgttgtaatgggtgacggtgctgtt
ggcctttgtgcgattattgctgctaagatgcggggcgctaagaagatcatttctactagt
cgccatgctgaccgtcaagcccttgctaaggaatttggtgctactgacaatgttgctgaa
cgtagtgacgaagcggttcaaaagatcatggaactcactaacggtgccggtgctgatgct
gtccttgaatgcgttggtactgaacaatcaactgatactgccatgaaagttggccgtcca
ggtaccatcgttggtcgggttggcttacctcataccccaaagatggacatgacggtgcta
ttctacaacaacactattgtcggcggtggtccagcatcagtaaccacttacgacaaggac
gtattgttgaaggctgttcttgatggtgacattaaccctggtaaggtctttactaagagc
ttcgaccttgaccaaattcaagaagcttatgaagcaatggataagcgtgaagcaatcaag
tcttacattattatggatggctttgaacgcgattaa

DBGET integrated database retrieval system