KEGG   Lactobacillus reuteri JCM 1112: LAR_0050Help
Entry
LAR_0050          CDS       T00735                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
lrf00071  Fatty acid degradation
lrf00072  Synthesis and degradation of ketone bodies
lrf00280  Valine, leucine and isoleucine degradation
lrf00310  Lysine degradation
lrf00362  Benzoate degradation
lrf00620  Pyruvate metabolism
lrf00630  Glyoxylate and dicarboxylate metabolism
lrf00640  Propanoate metabolism
lrf00650  Butanoate metabolism
lrf00900  Terpenoid backbone biosynthesis
lrf01100  Metabolic pathways
lrf01110  Biosynthesis of secondary metabolites
lrf01120  Microbial metabolism in diverse environments
lrf01130  Biosynthesis of antibiotics
lrf01200  Carbon metabolism
lrf01212  Fatty acid metabolism
lrf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lrf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LAR_0050
   00630 Glyoxylate and dicarboxylate metabolism
    LAR_0050
   00640 Propanoate metabolism
    LAR_0050
   00650 Butanoate metabolism
    LAR_0050
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LAR_0050
   00072 Synthesis and degradation of ketone bodies
    LAR_0050
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LAR_0050
   00310 Lysine degradation
    LAR_0050
   00380 Tryptophan metabolism
    LAR_0050
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LAR_0050
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LAR_0050
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LAR_0050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lrf04147]
    LAR_0050
Enzymes [BR:lrf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LAR_0050
Exosome [BR:lrf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LAR_0050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C SpoVAD ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: BAG24566
Position
64655..65833
Genome map
AA seq 392 aa AA seqDB search
MEKVYIVAAQRTPIGKFNGQLASKSAVELGAIAIKAAVEKAKLSENDIDQVLMGNVIQAG
TGQNPARQASMAAGLGEQVPAITINDVCASGMSSVDLAASLIRAGQANVIVAGGMESMSQ
APYVLPKARNGYRFGNGTLLDAMQSDALNDVYGGYPMGITAENINDKYQITRHQQDEFAL
MSHQRAVKAQKAGYFDSEIVPVEVKQKRTTVTVTVDEAPRPDTSLAALAKLKPAFKSDGS
VTAGNASGINDGGAALVLASESAVNRLGLTPLAEWQGSAVVGLDPALMGLGPYYAIKKLL
KNQQLSADDVDTYEINEAFATQALVCQNLLHLDPRAVNPWGGAIALGHPVGCSGARIIVT
MISEMHRDNHELGIASLCVGGGMGEAVLLKKI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggtttacattgttgctgctcagcgaacaccaatcggtaagtttaacggtcag
ttagcttcaaagtctgcagttgaattaggagcgattgcaattaaagcggctgttgaaaag
gcaaagctcagcgaaaacgatattgaccaagtgttaatggggaatgttattcaagcagga
acgggacaaaatccagcgcgtcaagcatcaatggccgctggattaggtgagcaggttccg
gcaataacgattaatgacgtctgtgcgtcgggaatgtccagtgttgacctggcagcaagt
ttgattcgcgcaggacaggctaatgtaattgttgccggggggatggaaagtatgtcccaa
gctccatatgttcttcctaaggcacggaatggctatcgatttgggaatggaaccttgctt
gatgcgatgcaaagtgatgcattaaatgatgtttatggcggttatccgatgggaattact
gctgaaaatatcaatgataagtatcagattactcgtcaccaacaagacgaatttgctttg
atgagccaccaacgtgcggtaaaggctcaaaaagcaggctatttcgattcagaaattgta
ccagttgaagttaagcagaaacgaacaacagtgactgtaactgttgacgaagctccacga
ccagatacttcactagcggctttagcaaaattaaaaccagcttttaaatctgacggaagt
gtgactgcagggaatgcctcgggaattaatgatggtggagctgccttggttcttgcttct
gaaagtgcagtcaaccgattaggattaactccattggctgagtggcaaggatctgcagtt
gttggtcttgatccagcattgatgggtttgggaccatattatgcaatcaagaagctctta
aaaaatcagcagctgtcggcagatgacgtagatacttacgaaattaatgaggcgtttgcg
acccaagcccttgtctgtcagaacttgcttcatcttgatcctagggctgtcaatccttgg
ggtggggcaattgcattaggccatcctgttgggtgttcaggagcacgaattatcgtcacg
atgattagtgaaatgcatagggataatcatgaactcggcattgcttcgctgtgtgtcggg
ggcggaatgggtgaagcggttctgcttaagaaaatttag

DBGET integrated database retrieval system