KEGG   Lactobacillus reuteri JCM 1112: LAR_0201Help
Entry
LAR_0201          CDS       T00735                                 

Definition
(GenBank) methionyl-tRNA synthase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
lrf00450  Selenocompound metabolism
lrf00970  Aminoacyl-tRNA biosynthesis
lrf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LAR_0201
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LAR_0201
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lrf01007]
    LAR_0201
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lrf03016]
    LAR_0201
Enzymes [BR:lrf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LAR_0201
Amino acid related enzymes [BR:lrf01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LAR_0201
Transfer RNA biogenesis [BR:lrf03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LAR_0201
 Prokaryotic type
   Other AARSs
    LAR_0201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f ARL2_Bind_BART YihI
Motif
Other DBs
NCBI-ProteinID: BAG24717
Position
245375..247402
Genome map
AA seq 675 aa AA seqDB search
MAEQKPTYYITTPIYYPSGKLHIGNSYTTIACDAEARFKRLMGYDVFYLTGTDEHGLKIE
QKAEKLGMKPQEYVDQMAAQIKELWKKLEITNDKFIRTTDDYHEKAVQKIFQQLLDQGDI
YKGKYTGWYSVDDEEYFTESQLAEVYRDEDGNVIGGKAPSGHEVQLVEEESYFFKMSKYA
NWLMNYYKEHPDFIEPQSRMNEMINNFLKPGLEDLAVTRTSFNWGVKVPSDPKHVVYVWI
DALSNYITALGYGSDDDSLFKKYWPADVHMVGKEIVRFHTIYWPIMLHALGLPLPKHIIG
HGWLTMRDGKMSKSKGNVIYPETLVDRYGLDATRYYLLRAMPFGNDGVFSPEDFVDKVNY
DLANDLGNLLNRTVAMINKYQNGKLVGTNDATTDFDADLEQTASDVIAEYKELMDKTRFA
EALATVWKLVSRANKYIDETEPWVLAKDDSKKDVLSDVMTHLAKSLWIIAALIQPIMPHA
PKQIVEQLGIEGTDLSLTDLQFNDFPAEAQVVAKGTPIFPRLDVKAEVEFIKSKMTANEK
KKGRKAMAEAKEKAQETAQEEKTDGKKPIRIDVFDKVELKVAQITAADHVEGADKLLKFH
MDDGTEEGRQILSGIAKWYPDPSVLVGKKVLIVANLKPRKMRGELSQGMLLSAEKDGNVQ
VVTVPDNLVPGMGVE
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaaaaaccaacttattacattacaacaccaatttactatccatctggtaaa
ctccatattggtaattcatacacaacaattgcatgtgatgcagaagcacgttttaagcgt
ttgatgggctatgacgtattctacttgacaggaaccgatgagcatggccttaagattgaa
caaaaggctgaaaaactcggcatgaagccacaagaatacgttgatcaaatggctgcccaa
attaaagagctatggaaaaaacttgaaattacaaatgacaagtttattcggacaaccgat
gactaccatgaaaaagctgtccaaaagatttttcaacaattgcttgaccaaggggatatt
tacaagggcaagtatactggttggtactcagttgatgatgaagaatacttcacagaaagt
cagttagcagaagtttaccgtgatgaagacggtaatgtgatcggtggaaaagcgccatca
ggtcatgaagttcaattagttgaggaagaatcatacttctttaagatgagcaagtatgct
aactggttaatgaactactataaggaacatcctgattttatcgaaccgcaatcacggatg
aatgaaatgattaataacttcttaaagccaggactagaagatcttgcagttacgcggaca
tcatttaactggggggttaaggttcctagtgatcctaagcacgtggtatacgtatggatt
gatgcattatcaaactatattactgcgctgggatatggtagtgatgatgatagtcttttc
aagaagtactggcctgctgatgttcacatggtaggaaaagaaattgttcgtttccatacg
atttactggccaatcatgcttcatgcgcttggcttaccattgccaaaacacatcatcggt
catggttggttaacaatgcgtgacggtaagatgtcgaaatcaaagggaaatgttatttat
cctgaaactcttgttgatcgctacggccttgatgccacacgttactacttattgcgggca
atgccatttggtaatgatggcgtctttagtccagaagactttgttgataaggtaaactat
gaccttgctaacgatctaggaaacttgctcaatcggactgttgcgatgattaataagtat
caaaatggtaaattagttggcactaatgatgcaacgactgattttgatgctgatttagaa
caaactgctagtgatgtaattgctgagtataaagaattaatggataaaacacggtttgct
gaagcattggcaactgtttggaagttggttagtcgtgctaacaagtacattgatgaaact
gaaccatgggtactagcaaaagatgatagtaagaaggatgtattatcagatgtgatgacc
catctagcaaagagtttgtggattattgcagccttaattcaaccaattatgccgcatgca
ccaaagcaaattgttgaacaacttgggattgaagggactgacttatcattaactgatctt
caatttaatgatttcccagcagaagctcaggttgtcgccaaaggaactccgatcttccca
cgtttggatgtgaaggccgaggttgaatttattaagagcaagatgacagcaaacgaaaag
aagaaaggaagaaaggcaatggctgaagcaaaagaaaaagcccaagaaacagcacaagaa
gagaaaacagatggcaaaaagccaattcggattgatgtctttgacaaagttgaattgaaa
gtagctcaaatcactgctgccgatcatgtagaaggtgctgataagcttctaaaattccac
atggatgatggaacagaagaaggccggcaaatcctttctggaattgccaaatggtatcca
gacccttctgttttagtaggtaagaaagttttgattgttgctaacttgaaaccacggaaa
atgcggggcgaattaagccaaggaatgcttttgtctgctgaaaaagacggtaatgttcaa
gtagtaactgttcctgacaatttagtacctggaatgggcgttgaataa

DBGET integrated database retrieval system