KEGG   Lactobacillus reuteri JCM 1112: LAR_0291Help
Entry
LAR_0291          CDS       T00735                                 

Definition
(GenBank) cysteinyl-tRNA synthase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
lrf00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:lrf00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LAR_0291
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lrf01007]
    LAR_0291
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lrf03016]
    LAR_0291
Enzymes [BR:lrf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     LAR_0291
Amino acid related enzymes [BR:lrf01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   LAR_0291
Transfer RNA biogenesis [BR:lrf03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LAR_0291
 Prokaryotic Type
    LAR_0291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1 tRNA-synt_1f FTCD_C TipAS
Motif
Other DBs
NCBI-ProteinID: BAG24807
UniProt: B2G5S5
Position
351487..352899
Genome map
AA seq 470 aa AA seqDB search
MLTIYNTLTRKKEEFKPLHPGVVNMYVCGPTVYNYIHIGNARSAIAFDTVRRYLEFKGYK
VNYVSNFTDVDDKMIKAAAEQGITVPQLAEKYINAFMEDTAAINIEPATLHPRATENITE
IIKFVQGLIEKGYAYPKDGDVYYRARKFNHYGQLSGQSLDDLEVGASEHVSADEVNKKED
PLDFALWKAAKPGEISWDSPWGKGRPGWHIECSVMSTKYLGKTIDIHAGGQDLEFPHHEN
EIAQSEAETGQKFVRYWMHNGFVTIGKDNEKMSKSLHNFITVHEIIKEVDPQVLRFFMAT
TQYRRPIQYSQANLTDAQNNLNHIQTAFDNLTYREQDADEGDVQEVTDRLEQFHHQFITA
MDDDINVQNGIATVYELVKYANVYAQQDNVSLGAIQAIKKELVELMSIFGVKLEASDNQI
NDEKIKQLIEERNIARKNKDFARSDEIRDNLKKQGIILEDTPQGTRYKKE
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgctaacaatttacaatacgttaacaagaaaaaaagaagaatttaagccattgcatcca
ggcgttgttaacatgtatgtctgtggtccgacggtttataattacattcatattggaaat
gcgcgcagtgcgatcgcctttgatacagtccggcgttatcttgaatttaagggatataaa
gtaaattacgtttcaaactttacggacgttgacgataagatgattaaggcggcggccgag
caagggattaccgttccacaattagcggagaagtatatcaatgcttttatggaagatacc
gcagcgattaatattgaaccagctactcttcatccccgggcaacagaaaatattacggag
atcattaaattcgtgcaaggattaatagagaaaggatatgcttaccctaaagatggggat
gtttattatcgggcacgaaagtttaaccactatggccagctttctgggcaatcacttgat
gaccttgaagttggggcaagtgaacatgttagtgcggatgaggttaataagaaggaagat
ccgcttgattttgctttatggaaagcagctaagcccggcgaaattagttgggattcacca
tggggaaaaggtcgtccaggatggcatatcgaatgttcagtgatgtctactaagtacttg
ggaaagacaattgatattcatgcggggggacaagaccttgaattccctcaccatgaaaat
gagattgcccaaagtgaagcagaaacgggccaaaaatttgttcgttactggatgcataat
ggcttcgtaacaattggaaaagacaacgagaagatgagtaagtctctccataatttcatt
actgttcatgaaattatcaaggaagtagatcctcaggttttacgtttctttatggcgact
acgcaatatcggcgtccaattcaatatagccaggcaaacctaactgatgcgcaaaataat
cttaatcacattcaaacagcctttgataacttgacttatcgtgaacaagatgccgatgag
ggagatgttcaagaagtcactgatcggcttgagcaattccatcaccaatttattacagca
atggatgatgacatcaatgttcaaaacgggattgccacagtctacgaattagttaaatat
gcaaatgtttatgctcaacaagataatgttagcttaggtgccattcaagcaatcaaaaaa
gagcttgttgaattgatgagtatttttggcgttaagcttgaagcaagtgacaatcaaatc
aatgatgaaaagattaagcaattgattgaagaacgaaatatagcacggaagaataaagat
tttgcgcgaagtgatgaaattcgagacaatcttaaaaaacaagggattattcttgaagat
actcctcaaggaacgcgttacaaaaaggaatag

DBGET integrated database retrieval system