KEGG   Lactobacillus reuteri JCM 1112: LAR_1224Help
Entry
LAR_1224          CDS       T00735                                 

Definition
(GenBank) dipeptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
lrf00300  Lysine biosynthesis
lrf01100  Metabolic pathways
lrf01120  Microbial metabolism in diverse environments
lrf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LAR_1224
Enzymes [BR:lrf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     LAR_1224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: BAG25740
Position
complement(1376175..1377578)
Genome map
AA seq 467 aa AA seqDB search
MTDWMKAAEAQKENYLNDLVALMKIPSVRDDSAATDEYPLGPRPAQALKAFLEMAEQDGF
KVKNIDNLVGYAEWGEGDETLAILAHLDVMPAGKGWDTDPFDPVIKDGNLYGRGASDDKG
PGMAAYYALKYLKDQGVKFNKKVRFIVGTDEESNWTGMHRYFEVEPAPTFGFSPDAEFPV
INGEKGQVSLLLDVPAGNGDASTQLVSFESGLRFNMVPREAVALMRTDNPQEVTNDFGHF
IEENPVEGNIESTDKGLKITVIGKAAHGMEPEKGINAATYLAKFLNRYDFGGGAKSFIEF
LADYLHLDTRMDGFNGAYTDPVMGELTMNAGILNFDADKGGHIDMNFRFPKGVTPDKLED
TVKAIADKLQIKVTQGPSQAPHYVDPDDPIVKTLMQAYIDQTGDTDAKPEVVGGGTYGRL
MKRGVAFGALMPHTPNTMHQANEYQPVKDLITSMAIYMEAINNLVTD
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
ttgactgattggatgaaagccgcagaggcgcaaaaagaaaattatttaaatgatctcgta
gcattaatgaagatccccagtgtccgtgatgattcggcggcaacagatgaatacccgctt
ggccctcgtcctgcgcaagcgctaaaagcatttttagagatggcagaacaagacggtttt
aaagtaaagaacatcgataaccttgttgggtatgctgaatggggtgaaggcgatgaaaca
cttgctattttagcccatcttgacgtaatgcctgctggtaagggttgggatacggatcca
tttgacccagttatcaaggatggcaacttatatggtcgtggtgcttctgatgataaggga
cctggaatggccgcttactatgccttgaagtatttgaaagatcaaggcgtaaagtttaac
aagaaagttcgttttatcgttggaactgatgaagaaagtaactggactggaatgcaccgt
tactttgaagttgagccagccccaacatttggtttttcaccagatgcggaattcccagta
attaacggtgaaaagggtcaagtatcgctcttgcttgatgtccctgctggcaatggggat
gcctcaacacaactagttagttttgaatctggcttacgtttcaacatggtaccgcgggaa
gcagttgccctcatgcggacggataaccctcaagaagttactaatgattttggccacttt
attgaagaaaacccggttgaaggtaatattgaatcaacagataaggggcttaagattact
gtcatcggaaaagctgcgcatggaatggaaccagaaaagggaatcaatgcagcaacctac
cttgcaaagttcttaaatcgatatgactttggtggaggcgcaaagagcttcattgaattc
ttagctgattatcttcatttagatacgcggatggatggctttaatggtgcttacactgat
ccggtaatgggtgaattaactatgaacgccggaattttaaactttgatgcggacaagggt
ggccacattgacatgaacttccgcttccctaaaggtgtgacaccagataagctagaggat
actgtaaaggcgattgccgacaaattacaaattaaagttacacaaggtccatctcaagct
ccacattatgttgatccagatgatccaatcgttaagacattgatgcaagcttatattgac
caaactggagatacagacgcaaaaccagaagtcgttggtggtggaacttatggtcgtttg
atgaagcggggcgttgcctttggtgctttaatgccacatacgccaaatacaatgcatcag
gctaatgaatatcaacctgttaaagatttaattacatcgatggcgatttacatggaggca
attaataatctcgttactgattaa

DBGET integrated database retrieval system