KEGG   Lactobacillus reuteri JCM 1112: LAR_1448Help
Entry
LAR_1448          CDS       T00735                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
lrf00010  Glycolysis / Gluconeogenesis
lrf00052  Galactose metabolism
lrf01100  Metabolic pathways
lrf01110  Biosynthesis of secondary metabolites
lrf01120  Microbial metabolism in diverse environments
lrf01130  Biosynthesis of antibiotics
Module
lrf_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAR_1448
   00052 Galactose metabolism
    LAR_1448
Enzymes [BR:lrf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     LAR_1448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: BAG25964
Position
1634571..1635608
Genome map
AA seq 345 aa AA seqDB search
MEISKVPFGTYKGDPVTKYILTNDNGVQVGILDFAGLLQSFKVPTKDGGKADMILTSENL
DEFTNNGFCTNRLIGRVAGRIADGKFSINGKDYQTEQNEGKNALHGGTNGFYNHIWHVDS
TEATNNSVSITLSLTLSPEVDTYPGKMHVTATYTLTNDDFLSLKMSATTDADTLFNPTNH
TYWNMAAANVPTVDQLKLYVNSENHLAVDDGKIPTGEKIANEGTPFDFSTPTTMGDALEK
MSSTKENGFDDIWEVTPSLTKPVATLEDPESGRKMSLYSDRNGLVMYTMNSDDAAVYNHG
QVHPHLGLAMEAQNLSDAPHHPEFGDITLHPGEEKAYTIKWHVEY
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggaaatatctaaagtaccatttggaacctacaaaggcgatccagtaacaaaatacatt
ttaacgaacgataatggtgttcaagtaggaattcttgattttgccggtttacttcaatct
tttaaagttccaacaaaagatggtggtaaggccgatatgattttgacttctgaaaacctc
gacgaatttactaataatggcttttgtactaatcgcttaatcggccgggttgctggacga
attgcagatggtaagttcagtattaacggtaaagattaccaaaccgaacaaaacgaaggt
aaaaatgctcttcatggtggaactaatggtttttacaatcatatttggcatgttgacagc
acagaagcaactaacaattctgtttcaatcactcttagtttaaccttaagtcctgaagtt
gatacgtatcctggtaagatgcatgtcactgcaacctacactttaactaatgacgacttt
ctttcacttaagatgtcggctactactgatgcagatacgttgttcaaccctaccaaccac
acatactggaatatggcagcagcaaatgttccaacggtggatcaattaaagctttatgtc
aactccgaaaatcacttagctgttgacgacggcaagattccaactggtgaaaagatcgct
aacgaaggaactccatttgactttagtaccccaactacaatgggcgatgcgctagaaaaa
atgagttcaactaaggaaaacggttttgacgatatttgggaagttactcctagtctcaca
aagccagttgccacacttgaagatccagaaagcggccgaaagatgagtctttactccgat
cgtaacggattagttatgtatacgatgaactcagatgatgcagcggtttacaatcacgga
caagttcatccccaccttggattagcaatggaagcgcaaaatctttcggatgcacctcat
cacccagaatttggcgatattactttacatccgggcgaagaaaaagcatacaccattaaa
tggcacgttgaatactaa

DBGET integrated database retrieval system