KEGG   Lactobacillus reuteri JCM 1112: LAR_1489Help
Entry
LAR_1489          CDS       T00735                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
lrf00010  Glycolysis / Gluconeogenesis
lrf00071  Fatty acid degradation
lrf00350  Tyrosine metabolism
lrf00625  Chloroalkane and chloroalkene degradation
lrf00626  Naphthalene degradation
lrf01100  Metabolic pathways
lrf01110  Biosynthesis of secondary metabolites
lrf01120  Microbial metabolism in diverse environments
lrf01130  Biosynthesis of antibiotics
lrf01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lrf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LAR_1489
  Lipid metabolism
   00071 Fatty acid degradation
    LAR_1489
  Amino acid metabolism
   00350 Tyrosine metabolism
    LAR_1489
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LAR_1489
   00626 Naphthalene degradation
    LAR_1489
Enzymes [BR:lrf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LAR_1489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C ACP_syn_III PALP
Motif
Other DBs
NCBI-ProteinID: BAG26005
Position
complement(1684702..1685757)
Genome map
AA seq 351 aa AA seqDB search
MKKAIFEKAGQMKIVDVDRPTIEKPDDVIIKVVRTCVCGSDLWNFRGINPVEKDSENSGH
EAIGIVEEVGEDITTVKPGDFVIAPFTHGCGHCAACRAGFDGSCQSHNDNFSSGVQAQYV
RFQHGQWALVKVPGKPSDYSEGMLKSLLTLADVMATGYHAARVANVSDGDTVVVMGDGAV
GLCAIIAAKMRGAKKIISTSRHADRQALAKEFGATDNVAERSDEAVQKIMELTNGAGADA
VLECVGTEQSTDTAMKVGRPGTIVGRVGLPHTPKMDMTVLFYNNTIVGGGPASVTTYDKD
VLLKAVLDGDINPGKVFTKSFDLDQIQEAYEAMDKREAIKSYIIMDGFERD
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagctatttttgaaaaggcgggtcaaatgaagattgttgatgttgaccgtcca
acaattgaaaagcctgatgacgtaattattaaggtagtgcggacctgtgtttgtggttct
gacctatggaacttccgaggaattaatccggttgaaaaagattctgaaaactctggccat
gaagcaattggaattgttgaagaagttggtgaagatatcactactgtcaaacctggggac
tttgtgattgctccatttactcatggatgtgggcactgtgctgcttgtcgcgcgggcttc
gatggttcttgccaaagtcacaacgataactttagctctggtgtgcaagctcaatacgtt
cggttccaacacggtcaatgggcgcttgttaaagttccgggcaagccaagtgactacagt
gaaggaatgcttaagtccctcttaacccttgctgatgttatggctactggttaccacgct
gcacgagttgctaacgttagtgatggtgatacagttgttgtaatgggtgacggtgctgtt
ggcctttgtgcgattattgctgctaagatgcggggcgctaagaagatcatttctactagt
cgccatgctgaccgtcaagcccttgctaaggaatttggtgctactgacaatgttgctgaa
cgtagtgacgaagcggttcaaaagatcatggaactcactaacggtgccggtgctgatgct
gtccttgaatgcgttggtactgaacaatcaactgatactgccatgaaagttggccgtcca
ggtaccatcgttggtcgggttggcttacctcataccccaaagatggacatgacggtgcta
ttctacaacaacactattgtcggcggtggtccagcatcagtaaccacttacgacaaggac
gtattgttgaaggctgttcttgatggtgacattaaccctggtaaggtctttactaagagc
ttcgaccttgaccaaattcaagaagcttatgaagcaatggataagcgtgaagcaatcaag
tcttacattattatggatggctttgaacgcgattaa

DBGET integrated database retrieval system