KEGG   Lactobacillus reuteri JCM 1112: LAR_1588Help
Entry
LAR_1588          CDS       T00735                                 

Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminotransferase HemL
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
lrf00860  Porphyrin and chlorophyll metabolism
lrf01100  Metabolic pathways
lrf01110  Biosynthesis of secondary metabolites
lrf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lrf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LAR_1588
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lrf01007]
    LAR_1588
Enzymes [BR:lrf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     LAR_1588
Amino acid related enzymes [BR:lrf01007]
 Aminotransferase (transaminase)
  Class III
   LAR_1588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAG26104
UniProt: B2G9H2
Position
complement(1800881..1802176)
Genome map
AA seq 431 aa AA seqDB search
MSKLDTTKSKIAFKEAQKYMPGGVNSPVRAFKNVGGDPLFIDHGKDEYIYDIDGNKYIDY
VLSWGPLILGHADDHVVAELDKAVAKGTSYGAPTLQETELAKIVNKIMPSIEMIRMVSSG
TEATMSAIRLARGYTHRKKIVKFVGNYHGHSDSLLVDAGSGLATFGINTSPGVPDDLAYD
TLTVAYNDVAGVKKLFAEHGDEIACAIVEPVAGNMGVIPGTQEFLQTLRNVTNEHGALLI
FDEVMSGFRAAYHGVQSLVNITPDLTTLGKVIGGGLPVGAFGGRREIMENITPAGDIYHA
GTLSGNPLAMTGGISTLEQLTPDDYVEMDKKVTALTEGIKHAADQYGVPMTVHHVGTMWS
YFYNSDPINNFDDVKACDQKLFEKCFWELLAHGVYVAPSQFETNFISTKHTDEDIEKTIA
AFDAAFNAATK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaaattagatacaacaaagtcaaagatagcttttaaggaagcacaaaagtatatg
ccaggtggggtcaatagccctgtcagagcatttaaaaatgttggtggtgatcctttattc
attgaccatggtaaggacgaatatatttatgacattgatggcaataagtacattgattat
gttctttcatgggggccactaattttaggacatgcagatgatcatgtagttgcagagtta
gataaagcagttgctaagggaacaagctacggtgcgccaacccttcaagaaactgaattg
gcaaaaattgttaataagattatgccgtcaattgaaatgattcgaatggtttcatctgga
actgaagcaacaatgagtgcgatcagattagcacgtggatatactcatcgaaaaaaaatc
gttaaatttgtgggtaactatcatggtcatagcgattcattgctagttgatgctggctca
ggattagcaacgtttggaattaatacttcgcctggtgttcccgatgatctggcttatgat
acacttaccgttgcctataatgatgttgctggtgttaagaaacttttcgctgaacatggt
gatgaaattgcctgtgcgattgttgaaccggttgccggcaatatgggagttattccggga
acccaagagttcttacaaactttacgtaacgttaccaatgaacatggtgcattattgatc
tttgatgaggttatgtcagggttcagggcagcttatcatggtgttcaaagtctagtcaat
atcacgccggacttaaccactttaggcaaagtaatcggtggtggactcccagttggtgct
tttggtggacgtcgtgaaattatggaaaatattacgcctgctggagatatttatcatgcc
ggaacgttgtcaggtaatccgttagcaatgactggtggaattagcaccttagaacaatta
acaccagatgattatgttgaaatggataaaaaagttactgctttaacagaaggcattaaa
catgcagctgaccaatatggtgtaccaatgacagtgcaccatgttggtacaatgtggagt
tacttttataacagtgatccaattaataattttgatgatgttaaagcttgtgatcagaag
ttatttgaaaagtgtttctgggaattattagctcatggtgtatatgtagcgccatcgcaa
tttgaaactaactttatctcaactaaacacaccgatgaggacattgaaaagacaattgca
gcatttgatgcagcatttaatgcggcaaccaagtaa

DBGET integrated database retrieval system