KEGG   Lactobacillus reuteri JCM 1112: LAR_1653Help
Entry
LAR_1653          CDS       T00735                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
lrf  Lactobacillus reuteri JCM 1112
Pathway
lrf00030  Pentose phosphate pathway
lrf00480  Glutathione metabolism
lrf01100  Metabolic pathways
lrf01110  Biosynthesis of secondary metabolites
lrf01120  Microbial metabolism in diverse environments
lrf01200  Carbon metabolism
Module
lrf_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:lrf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LAR_1653
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LAR_1653
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lrf04147]
    LAR_1653
Enzymes [BR:lrf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     LAR_1653
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     LAR_1653
Exosome [BR:lrf04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   LAR_1653
  Exosomal proteins of colorectal cancer cells
   LAR_1653
  Exosomal proteins of bladder cancer cells
   LAR_1653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: BAG26169
Position
1856126..1857607
Genome map
AA seq 493 aa AA seqDB search
MATENKAVITLFGATGDLAKRKLYTALFKLYQKGYLADHFALLGTSRRPLTDEEFQQIVR
ESISNIPETENGQAEAFSKHFFYKSHDVTKPEHYEILKQRLAELDEQFGAEGNRLFYMSM
APQFFGTIALNLKKQGLLTDNGFNRLVIEKPFGRDFESAKKLNDELSQTFSENQIFRIDH
YLGKEMVQNIQALRFGNTMIESLWNNRYIDNIQVTLSEKLGVEERAGYYDQSGALRDMVQ
NHIMQIVAQLAMEQPVAFTDADVRVEKIKALRSLRLYTPSEAAANFVRGQYDAGDGTNAY
RHEDGVDPESGTETFVAAKLMFDNYRWSGVPFYVRTGKKLADKFTRIDVVFKKPLIDIFA
NPRSESDQSLNSNVLTIFVEPNSGFAIQLNAKRAGQGFTTEPVDLRFLQSDSDKKESPEP
YERLFHDALEGNHTNFASWAEIAYAWKFVDVIRKLWDIEKPQFPNYTPGSMGPAASDELL
ARDGRKWVYRLNH
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
ttggctacagaaaataaggctgtcattacattatttggtgcgactggtgaccttgcaaag
cgtaaactttatactgctttgttcaagttatatcaaaagggttacctagctgaccatttt
gcattactaggaacttcccgtcgtccattaactgacgaagaattccaacaaatcgttcgt
gaatctattagtaacattccagaaactgagaatggccaagcagaagcattctcaaagcac
tttttctacaagtcacatgatgttactaaaccagaacattacgaaatccttaagcaacgc
cttgctgaattagatgaacaatttggcgctgaaggcaaccgtctcttctacatgtcaatg
gcaccacaattcttcggtactattgccttgaatttgaagaagcaaggattattaactgac
aatggttttaaccgtcttgttattgaaaagccatttggtcgtgactttgaatctgccaag
aagcttaacgatgaattatcacaaacatttagtgaaaatcaaattttccggattgaccac
taccttggtaaggaaatggttcaaaacattcaagcattacgttttggtaacaccatgatt
gaatcactctggaataatcgttacattgacaacatccaagtaactttaagtgaaaagctt
ggggttgaagaacgtgctggttactatgaccaatctggtgcattacgtgatatggtgcaa
aaccacatcatgcaaattgttgcccaattagcaatggaacaacctgttgcatttactgat
gctgatgttcgagttgaaaagattaaggctcttcgtagtcttcgcctctacacgccatca
gaagcagctgctaactttgtccgtggacaatacgatgctggtgatggaactaacgcttac
cgtcatgaagatggtgttgatccagaatctggtactgaaacctttgttgctgctaagtta
atgtttgataactatcgttggtctggtgtaccattctacgttcgaactggtaagaagtta
gcagacaagtttactcgtattgatgttgtcttcaagaagccattaatcgatatctttgct
aacccacgttctgaaagtgaccaatctcttaactcaaacgtattaactatttttgttgaa
cctaactcaggttttgcaatccaattaaatgctaagcgcgcgggtcaaggcttcacaaca
gaacctgttgatttacgcttcttgcaaagtgattctgataagaaggaatctccagaacca
tatgaacgtcttttccatgatgcacttgaaggtaaccacacaaactttgcctcatgggct
gaaattgcttatgcctggaagttcgtcgatgttatccgtaaactttgggatattgaaaag
cctcaattccctaactacactcctggttccatgggtccagcagcttctgacgaactcttg
gctcgtgatggacgtaagtgggtttatcgtttaaatcattag

DBGET integrated database retrieval system