KEGG   Lactobacillus rhamnosus GG: LRHM_0772Help
Entry
LRHM_0772         CDS       T02100                                 

Definition
(GenBank) hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
lrg00361  Chlorocyclohexane and chlorobenzene degradation
lrg00625  Chloroalkane and chloroalkene degradation
lrg01100  Metabolic pathways
lrg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lrg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LRHM_0772
   00361 Chlorocyclohexane and chlorobenzene degradation
    LRHM_0772
Enzymes [BR:lrg01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     LRHM_0772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: BAI41299
Position
805237..805920
Genome map
AA seq 227 aa AA seqDB search
MYRIILFDVDDTLLDFKAGELKSLAKMFAKLKLTYTPRIEASYLKINANLWRDYEAGRIT
RPELFEVRFAKLFRHHRIDADPHLAERTYHHFLDQEAILLPHVMETLDALKDYRLFIVSN
GIEPVQRQRLATSGLIDYFEDIFVSDSVGSPKPTVAFFDYVAKRIPRFNRNETLIMGDSL
TSDIQGGINGKIDSIWFNPHFQPNRDQITPTYQLNEFSDLTKLLLAN
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgaattattttgtttgatgtggatgataccttgttggattttaaggcaggggaa
ttaaaaagcctggcaaaaatgtttgccaagctgaaattaacgtacacaccgcggattgaa
gcgagttatttaaagataaatgccaatttgtggcgcgattacgaagcaggtcgtatcact
aggccggaactttttgaagtgcggtttgccaagttatttcggcatcatcgcattgatgct
gatccgcacttggctgaacgcacttatcaccactttttggaccaagaagcgatcttattg
ccacatgttatggaaaccttggatgcattaaaagattatcgactcttcattgttagtaac
ggtattgagccggttcagcgccagcgattggccaccagtggcttgattgattactttgag
gatatttttgtttctgatagtgtgggtagtcccaaaccgactgtcgcgttctttgattat
gtcgctaaacgtattccgcggtttaatcgcaacgagacgttgattatgggcgactcgtta
acctcggatattcaaggcgggattaacggtaagattgattcgatctggtttaacccgcat
tttcagccgaatcgcgatcaaattaccccgacttaccaactgaacgaatttagtgatcta
actaaattgctcttggctaattaa

DBGET integrated database retrieval system