KEGG   Lactobacillus rhamnosus GG: LRHM_1639Help
Entry
LRHM_1639         CDS       T02100                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
lrg00010  Glycolysis / Gluconeogenesis
lrg00052  Galactose metabolism
lrg00500  Starch and sucrose metabolism
lrg00520  Amino sugar and nucleotide sugar metabolism
lrg00521  Streptomycin biosynthesis
lrg01100  Metabolic pathways
lrg01110  Biosynthesis of secondary metabolites
lrg01120  Microbial metabolism in diverse environments
lrg01130  Biosynthesis of antibiotics
lrg01200  Carbon metabolism
Module
lrg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lrg_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRHM_1639
   00052 Galactose metabolism
    LRHM_1639
   00500 Starch and sucrose metabolism
    LRHM_1639
   00520 Amino sugar and nucleotide sugar metabolism
    LRHM_1639
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LRHM_1639
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LRHM_1639
Enzymes [BR:lrg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LRHM_1639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: BAI42166
Position
complement(1724852..1725814)
Genome map
AA seq 320 aa AA seqDB search
MNDQKLIGVDLGGTTVKFAILTQDGEIQQRWSIDTNILDEGSHILPDIVTSINEHLDLYK
MTPADFVGIGMGSPGSVDSEAGTIIGAYNLNWKTLQQARKIIESGTGIPFSVDNDANVAA
LGERWKGAGENDPDVTFVTLGTGVGGGIIANGELLHGVAGSGGELGHVTVDPVNGYLCTC
GKRGCLETVASATGVVRVARDMAEEFAGDSKLKETLDDGDEISSKIVFDLAKEGDRLALM
IVDRVSFYLGLALANVGNLLNPKFIVIGGGVSAAGEFLLTRVDKYFKENTFPNVRETTSL
RLATLGNTAGVIGAASLALK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaccaaaaattgattggcgtcgacttaggcgggacgaccgtaaaatttgccatt
ttaacgcaggatggcgagattcaacaaaggtggagtattgacaccaatattttggatgaa
ggcagccatattttaccggacattgttacatctattaatgaacatctggatttatacaag
atgaccccggctgattttgtcggtattggcatgggttcgcctggatcagtggacagtgag
gcgggcacaattatcggtgcttacaacctaaactggaaaaccttgcagcaagccagaaaa
ataatcgaatcagggaccggcattccgtttagcgtggataatgacgccaatgttgcggcg
ttaggtgagcgctggaaaggcgccggtgaaaacgatcctgatgtcacgtttgtcacgctg
ggtaccggtgttggtggcgggattattgccaatggcgagctcttgcatggtgttgccggt
tccggtggtgagctaggccatgttaccgttgatccggttaatggctatctttgcacctgt
ggtaaacgtggttgccttgaaacagttgccagtgcgaccggtgtagttcgagttgcgcgt
gacatggcagaagaatttgccggcgactctaagttaaaagaaaccttggacgatggcgat
gagatttcgagcaaaattgttttcgacttggccaaggaaggcgatcgtctggcgttgatg
attgtggatcgggtttctttttacctcggtttggctttggccaatgtcggcaatcttttg
aatccgaaattcatcgttatcggcggcggtgtctccgcggccggtgaattcttgctgacg
cgagtcgacaagtacttcaaagaaaacaccttcccgaatgttcgtgaaactactagtttg
cggttggcgacactggggaatacagctggcgttatcggtgctgcaagcttggcactgaag
taa

DBGET integrated database retrieval system