KEGG   Lactobacillus rhamnosus GG: LRHM_1773Help
Entry
LRHM_1773         CDS       T02100                                 

Definition
(GenBank) putative acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
lrg00071  Fatty acid degradation
lrg00072  Synthesis and degradation of ketone bodies
lrg00280  Valine, leucine and isoleucine degradation
lrg00310  Lysine degradation
lrg00362  Benzoate degradation
lrg00380  Tryptophan metabolism
lrg00620  Pyruvate metabolism
lrg00630  Glyoxylate and dicarboxylate metabolism
lrg00640  Propanoate metabolism
lrg00650  Butanoate metabolism
lrg00900  Terpenoid backbone biosynthesis
lrg01100  Metabolic pathways
lrg01110  Biosynthesis of secondary metabolites
lrg01120  Microbial metabolism in diverse environments
lrg01130  Biosynthesis of antibiotics
lrg01200  Carbon metabolism
lrg01212  Fatty acid metabolism
lrg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lrg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LRHM_1773
   00630 Glyoxylate and dicarboxylate metabolism
    LRHM_1773
   00640 Propanoate metabolism
    LRHM_1773
   00650 Butanoate metabolism
    LRHM_1773
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LRHM_1773
   00072 Synthesis and degradation of ketone bodies
    LRHM_1773
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LRHM_1773
   00310 Lysine degradation
    LRHM_1773
   00380 Tryptophan metabolism
    LRHM_1773
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LRHM_1773
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LRHM_1773
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LRHM_1773
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lrg04147]
    LRHM_1773
Enzymes [BR:lrg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LRHM_1773
Exosome [BR:lrg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LRHM_1773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAI42300
Position
complement(1866082..1867263)
Genome map
AA seq 393 aa AA seqDB search
MEKVVILSAKRTPIGKLGGELAGASAVDLGVAAAKAAIKAARLDPQQLDQAIFGNVLQAG
SGQNVARQIALHSGMATNSTAMTINEVCGSGLKAIRLGQAAIQLGEANAVLVGGTESMSQ
VPYYAEAMRAGHKFGDTALVDGLSRDGLNDAFSQQPMGITAENVASRFQISRQTQDEFAL
RSHLRAAAAAAEGRFKSQIAPVTISGRHGDVTVDTDSAIRPDTSLAQLAKLPPVFEVGGT
VTAGNASGINDGAAALILMAKSKAEQLGLHYLATITDYTEVGIDPDIMGYAPKLAIDQLM
QKTGQTLTAIDQVELNEAFASQSVAVMRDLGLTDEQVNINGGALALGHPLGASGARIMVS
LLYNLAERRQQTGVAALCVGGGIGMAMQVTLHD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagttgtgattcttagtgccaagcggacgccgattggaaagttgggcggtgag
ttagcaggtgctagtgcagtggatttaggtgttgccgcagctaaggcggcgattaaagca
gcacggcttgatccgcaacaactggatcaagcaattttcgggaatgttttgcaggctgga
tcgggccagaatgttgcgcgtcagattgcgttgcatagtggcatggcgacgaactccacg
gccatgacgatcaatgaggtttgcggctctgggctaaaggcaattcggttaggtcaggcg
gcgattcaactaggtgaagctaacgcggtacttgtcggcggtaccgagagtatgagtcag
gtgccgtattatgctgaggcgatgcgggccgggcataagtttggcgatactgcgttggtg
gatggtcttagtcgcgatgggctaaacgatgcttttagtcagcaaccgatggggattacg
gcggaaaatgttgccagccgctttcagatcagtcgtcaaacgcaagacgagtttgcactg
cgctctcatctgcgtgcggccgctgctgctgcagaaggccggtttaaatcacaaattgcg
ccggtgaccatttccggccgacatggcgatgtcacggttgacacggattcggcgattcga
ccggatacatcattagcccagttagcaaaattaccgccagtttttgaagttggcgggacc
gtcacggctggtaatgctagcgggattaatgatggagcggctgcattgattcttatggcg
aagtcaaaagccgagcagttaggcctccactatttggctaccatcaccgactatacagaa
gtcgggattgacccggacatcatggggtatgcgcctaaattagcgattgaccagctaatg
caaaaaaccggacaaactttaacagccattgatcaagtggaattaaatgaagcattcgcc
tcgcaaagtgttgccgtgatgcgtgacctaggactgactgacgaacaggtgaatatcaat
ggcggagcgcttgctttaggccatcccttgggagcatccggcgcgcggattatggtttca
ttgctgtataatttggcggaacgcaggcaacaaaccggtgtcgcggcgttatgtgtcggt
ggtggtatcggtatggcgatgcaagttactttgcatgattag

DBGET integrated database retrieval system