KEGG   Lactobacillus rhamnosus GG: LRHM_2071Help
Entry
LRHM_2071         CDS       T02100                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
lrg00260  Glycine, serine and threonine metabolism
lrg00750  Vitamin B6 metabolism
lrg01100  Metabolic pathways
lrg01110  Biosynthesis of secondary metabolites
lrg01120  Microbial metabolism in diverse environments
lrg01230  Biosynthesis of amino acids
Module
lrg_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lrg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LRHM_2071
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LRHM_2071
Enzymes [BR:lrg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LRHM_2071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: BAI42598
Position
complement(2215629..2217143)
Genome map
AA seq 504 aa AA seqDB search
MRYTSTRDQRVSKTGQQAIKQGISEEGGLFVLPHLTDYRLNLQNLLGKDYETIAQNVLTT
LLPDFNTAALKKAIQFAYHKNFSDRRLTPVRSVGDFHVLELFHGPTSAFKDLGLQLLPQL
MRLALDPEDRIMILAATSGDTGTAALQGFKNVAQTGITVFYPDHGVSPIQERQMLTTTGN
NTRVFPIGGNFDQAQSAVKDLFTDTGFAARLQAEQVTLSAANSINIGRLIPQVVYYFSAY
LQLVESGAIELGQKVNFTVPTGNFGDVLAGFYAKLMGLPIHQLIAAANANHELADFLETG
IYDRNRPFLKTVAPSMDIQISSNLERLLYYKSGEDSSYVAKLMEELATTGRYQVRPDVLA
AIQADFAGGFAADAQIAASIAAVWKQNDYLLDPHTAVGYHVMQQYRETTGDSTPNVLLAT
ASPYKFPRAVAQALDLPVTGDDFAVMTQLHQMSGVPIPANLARLATLTAQPKHVVAPEEM
GQAIIAAAKEVFNNDQRVRSGNKR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcgatacacaagtacacgggatcagcgcgttagcaagactggacaacaagcgatcaag
caaggcatctccgaagaaggcgggttatttgttttaccgcatctaacggattaccgcttg
aatcttcaaaatttattaggtaaagattatgaaacgattgctcagaatgttctcacgacc
ctgttgcctgattttaacactgctgcgttgaaaaaggcgatccaatttgcctatcataaa
aatttttctgatcgccggctgacgcctgttcggtctgtgggtgattttcatgttttagag
ctgtttcatggcccaaccagcgcctttaaagacttggggttgcaactactaccgcaactg
atgcgcctggcactggatccggaagatcgcatcatgatcttagccgcaaccagtggcgat
accgggactgcggcgttgcaagggttcaaaaatgtcgcccaaaccgggattaccgtcttt
tatcctgatcatggggttagtccgattcaggagcggcaaatgttaacgacaaccggcaat
aacacacgggttttcccaattggcggtaactttgatcaagcgcagagtgccgttaaagat
ctctttaccgacaccggttttgcggcgcgtttgcaggcggaacaagtaacgctttcggcc
gccaattcgattaatatcgggcgtttgattcctcaggtggtttattatttttccgcctac
ttgcaactggttgaatcaggtgccattgagcttggtcaaaaggttaatttcactgttcca
actggcaactttggggatgtcctagctggtttctatgcgaagttaatggggttgccgatt
catcaactaattgccgcggccaacgccaaccatgaactggcggactttcttgaaaccggt
atttatgatcgcaatcgtccgttcctaaagacggtggcgccaagtatggatattcagatt
tccagtaacttggaacggctactctactataagagtggtgaagatagcagttatgtggct
aaattaatggaagaattggccacaaccggccgctatcaggtacggcccgatgttttggca
gcgattcaggctgattttgctggcggttttgccgcagatgcacagattgcagcttcaatt
gctgcggtttggaagcaaaacgactatttgttggatcctcacacggctgtcggctaccat
gtgatgcagcaatatcgggagacaaccggtgattcgacccctaatgtgctactcgcaacg
gctagtccatacaaatttccacgcgcggttgctcaagcccttgacttgccggtgacaggt
gacgactttgctgtgatgacccagttgcatcaaatgagtggtgttccgattcctgctaat
ctagcgcgcttggcaactttgactgcccaacctaaacacgtggtggcgccggaagaaatg
ggccaggcgatcattgcagccgcaaaggaggtttttaacaatgatcagcgtgtccgttcc
ggcaacaagcgctaa

DBGET integrated database retrieval system