KEGG   Lactobacillus rhamnosus GG: LRHM_2481Help
Entry
LRHM_2481         CDS       T02100                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lrg  Lactobacillus rhamnosus GG
Pathway
lrg00450  Selenocompound metabolism
lrg00970  Aminoacyl-tRNA biosynthesis
lrg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LRHM_2481
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LRHM_2481
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lrg01007]
    LRHM_2481
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lrg03016]
    LRHM_2481
Enzymes [BR:lrg01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LRHM_2481
Amino acid related enzymes [BR:lrg01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LRHM_2481
Transfer RNA biogenesis [BR:lrg03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LRHM_2481
 Prokaryotic type
   Other AARSs
    LRHM_2481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: BAI43008
Position
complement(2641080..2643062)
Genome map
AA seq 660 aa AA seqDB search
MASKPTFYVTTPIYYPSGKLHIGNAYTTIAADVLARYKRLMGYDVFFLTGTDEHGLKIEQ
KADKLGVTPQAYVDGMAAQIKQLWKMLEITNDKFIRTTDKEHVEAVQEIVERLIKQGDVY
LGEYTGWYSVEDEEYFTESQLSEVYRDKDGKVIGGKAPSGHEVQLVHEPSYFFKMSKYTD
RLLKYYDEHPDFVQPASRKTEMINNFIKPGLEDLAMSRTSFNWGVQIPSDPKHVVYVWVD
ALLNYITALGYGSNDHALFDKYWPANVQLIGKEIVRFHIIYWPIILMALDLPLPKKIYAH
GWLVMKDGKMSKSKGNAIYPDMIVERYGLDALRYYLMRAIPFGNDGIFTPEDFIDRINYD
LANDLGNLLNRTIAMINKYEDGILPAFKPDVTPFDQDLGDVAQAALAQYHKLMDELRFSD
ALDQVWKIVSRANKYIDETEPWKLAKDPAKKDQLDSVMAHLAESLRLIALLIQPVMTHAP
VQIFGQLGLDHENEDHKVVKWGALPAGAKVVEQGTPIFPRLDAEEEVAYIKSKMTPGTAK
AAVDEKTRKPEIDFKQFDKSEIRVAEILNVEPVKGADKLLKFTLDAGDEGTRQILSGIRE
FYPDYQKLKGKKVMAVVNLKPRKLKGEMSEGMLLSAESLDGKKITLLEVSENLENGSLVG
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcaaaccaactttttatgtgacgacaccgatttattatccatctggcaaacta
catatcggcaatgcgtatacgaccattgcggcagatgtattggcacgatataagcggttg
atgggttatgatgttttcttcctgaccgggacagatgagcatggcctcaagattgagcaa
aaagccgacaagctaggggtcacaccgcaagcttatgttgacgggatggcagcacagatc
aagcaactgtggaaaatgcttgagatcacgaatgataagtttattcggacaacggataag
gaacatgtcgaggcagttcaggaaatcgttgaacggctaattaagcaaggcgatgtttat
ctgggcgaatacactggctggtattcagtcgaggatgaagaatactttaccgagtcgcag
ctgtctgaagtttatcgtgataaagatggcaaagtcattggcggcaaggctccatctggt
cacgaggttcagctggttcatgaaccaagctacttctttaagatgagcaagtacacggat
cgtttgctgaagtattatgatgagcatcctgattttgtgcagccggcatcgcgtaagacg
gaaatgattaacaatttcatcaagcctggtctagaagatctggcaatgagccgcaccagt
tttaattggggcgttcagattccgtctgatcctaaacacgtggtttatgtctgggtcgat
gcgttgttaaactatattaccgcgctgggctatggcagcaacgatcacgccttatttgat
aaatactggccggctaatgttcagttaatcgggaaggaaattgttcgcttccacatcatt
tactggccgattattttgatggccttggatttgccattaccgaaaaagatttacgcacat
ggctggctggtcatgaaagacggcaaaatgagcaagtcaaaaggcaatgctatttatccg
gacatgattgtggaacgttacggactggatgcgctgcgttactacctgatgcgcgcgatt
ccatttggtaacgatggtattttcacgcctgaagatttcattgatcggattaattatgat
ttagcgaacgatctgggcaacttgttgaatcggacaattgctatgattaacaagtatgaa
gacgggatcttacctgccttcaagccggatgttaccccatttgatcaggatcttggcgat
gttgcgcaggcagcgttggcgcaatatcacaagcttatggatgaattacggttctcagat
gcgttggatcaggtctggaagatcgtttcccgcgccaataaatatattgatgaaaccgaa
ccatggaaactcgccaaagacccagccaagaaagaccagcttgattcggtcatggcacac
ttggctgaaagtttgcgcctgatcgctttactcattcagccagtgatgacccatgcaccg
gttcaaattttcggtcaacttggcttagatcacgaaaacgaagatcacaaagtcgtgaag
tggggagccttgcctgccggtgccaaagtcgtcgaacaaggcacaccgatcttcccgcgg
cttgatgctgaagaagaagtagcgtatatcaagagcaagatgacgcctggcacggctaaa
gcagctgtcgatgaaaagacccgcaagccggaaatcgacttcaagcaattcgataagagc
gaaatccgagtggcagaaattctaaacgttgaaccggtcaagggcgctgacaagctgttg
aagtttacccttgacgctggtgatgagggtacgcgccagattctgtccggtattcgtgaa
ttttatccggattaccaaaagttgaagggtaaaaaggtcatggctgtggtcaacctcaag
ccacgcaaacttaaaggcgaaatgtccgaggggatgctgttatcagccgaaagcttggac
ggcaagaagattacattgctggaagtctcagaaaacctggaaaatggcagtttggttggt
taa

DBGET integrated database retrieval system