KEGG   Lactobacillus rhamnosus GG: LGG_01062Help
Entry
LGG_01062         CDS       T00987                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
lrh00040  Pentose and glucuronate interconversions
lrh00052  Galactose metabolism
lrh00500  Starch and sucrose metabolism
lrh00520  Amino sugar and nucleotide sugar metabolism
lrh01100  Metabolic pathways
lrh01130  Biosynthesis of antibiotics
Module
lrh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lrh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LGG_01062 (galU)
   00052 Galactose metabolism
    LGG_01062 (galU)
   00500 Starch and sucrose metabolism
    LGG_01062 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LGG_01062 (galU)
Enzymes [BR:lrh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LGG_01062 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: CAR86957
Position
1074439..1075359
Genome map
AA seq 306 aa AA seqDB search
MSVKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEAKASGIEDILIVEGK
QKRSIEDHFDSAPELEQNLKEKHKDALLQLVHSTTDIGVNLFFVRQPYPRGLGDAVRLAK
SFVGDEPFVVMLGDDLMNDKVPLTKQLIDEYDKTHASILAVKKVPHDEVSAYGVIDPEKE
VSKDLYNVKKFVEKPAVADAPSDLAIIGRYLLTPEIFDILDNQKPGKGNEIQLTDAIDTL
NQTQRVFAHEFKGDRYDVGNKFGYVKTNVEYGLTHPEVKDELRAYILDLAAKLQSGNPVG
KPANKK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgaaagttcgcaaagcagtgataccggcagccgggcttgggacccgttttctg
ccagcaaccaaagctttagctaaggaaatgttgccgattgtcgacaaaccgaccattcaa
tttatcgttgaagaagctaaggccagtgggattgaggatattctgattgttgagggtaaa
caaaaacgctctattgaagatcattttgactcagcacctgagctggaacagaatctgaaa
gaaaaacataaagacgccttgctacagctggttcattccacaaccgacatcggcgtcaac
ttattcttcgtgcggcagccatatccgcgtggtcttggtgatgccgttcgcttagccaaa
tcgtttgttggcgatgagccattcgtggtcatgttgggtgatgacctgatgaatgacaaa
gtgccgttgaccaagcaattaatcgatgaatacgataagacccatgcgtccattcttgcc
gttaaaaaggtgccgcatgatgaagtatcggcatatggcgttattgatccggaaaaagaa
gtttccaaagacctctataacgttaagaaatttgttgaaaagccagccgttgctgatgcc
ccaagtgacttggcaatcatcggccgctacctgctgaccccggaaatttttgatattctt
gataatcaaaaaccaggcaaaggcaatgaaattcagttaaccgatgcgatcgatactttg
aaccaaactcagcgcgtctttgcacatgagtttaaaggtgatcgctatgatgttggtaat
aagttcggatacgtcaagaccaatgttgaatatggtttgacccatccggaagtaaaagat
gaactccgcgcgtacatccttgatctggctgctaagttgcagtcaggcaatcctgtgggg
aagccggcaaataagaaatag

DBGET integrated database retrieval system