KEGG   Lactobacillus rhamnosus GG: LGG_01839Help
Entry
LGG_01839         CDS       T00987                                 

Gene name
phbA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
lrh00071  Fatty acid degradation
lrh00072  Synthesis and degradation of ketone bodies
lrh00280  Valine, leucine and isoleucine degradation
lrh00310  Lysine degradation
lrh00362  Benzoate degradation
lrh00380  Tryptophan metabolism
lrh00620  Pyruvate metabolism
lrh00630  Glyoxylate and dicarboxylate metabolism
lrh00640  Propanoate metabolism
lrh00650  Butanoate metabolism
lrh00900  Terpenoid backbone biosynthesis
lrh01100  Metabolic pathways
lrh01110  Biosynthesis of secondary metabolites
lrh01120  Microbial metabolism in diverse environments
lrh01130  Biosynthesis of antibiotics
lrh01200  Carbon metabolism
lrh01212  Fatty acid metabolism
lrh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lrh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LGG_01839 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    LGG_01839 (phbA)
   00640 Propanoate metabolism
    LGG_01839 (phbA)
   00650 Butanoate metabolism
    LGG_01839 (phbA)
  Lipid metabolism
   00071 Fatty acid degradation
    LGG_01839 (phbA)
   00072 Synthesis and degradation of ketone bodies
    LGG_01839 (phbA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LGG_01839 (phbA)
   00310 Lysine degradation
    LGG_01839 (phbA)
   00380 Tryptophan metabolism
    LGG_01839 (phbA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LGG_01839 (phbA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LGG_01839 (phbA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LGG_01839 (phbA)
Enzymes [BR:lrh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LGG_01839 (phbA)
Exosome [BR:lrh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LGG_01839 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAR87734
Position
complement(1869371..1870552)
Genome map
AA seq 393 aa AA seqDB search
MEKVVILSAKRTPIGKLGGELAGASAVDLGVAAAKAAIKAARLDPQQLDQAIFGNVLQAG
SGQNVARQIALHSGMATNSTAMTINEVCGSGLKAIRLGQAAIQLGEANAVLVGGTESMSQ
VPYYAEAMRAGHKFGDTALVDGLSRDGLNDAFSQQPMGITAENVASRFQISRQTQDEFAL
RSHLRAAAAAAEGRFKSQIAPVTISGRHGDVTVDTDSAIRPDTSLAQLAKLPPVFEVGGT
VTAGNASGINDGAAALILMAKSKAEQLGLHYLATITDYTEVGIDPDIMGYAPKLAIDQLM
QKTGQTLTAIDQVELNEAFASQSVAVMRDLGLTDEQVNINGGALALGHPLGASGARIMVS
LLYNLAERRQQTGVAALCVGGGIGMAMQVTLHD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagttgtgattcttagtgccaagcggacgccgattggaaagttgggcggtgag
ttagcaggtgctagtgcagtggatttaggtgttgccgcagctaaggcggcgattaaagca
gcacggcttgatccgcaacaactggatcaagcaattttcgggaatgttttgcaggctgga
tcgggccagaatgttgcgcgtcagattgcgttgcatagtggcatggcgacgaactccacg
gccatgacgatcaatgaggtttgcggctctgggctaaaggcaattcggttaggtcaggcg
gcgattcaactaggtgaagctaacgcggtacttgtcggcggtaccgagagtatgagtcag
gtgccgtattatgctgaggcgatgcgggccgggcataagtttggcgatactgcgttggtg
gatggtcttagtcgcgatgggctaaacgatgcttttagtcagcaaccgatggggattacg
gcggaaaatgttgccagccgctttcagatcagtcgtcaaacgcaagacgagtttgcactg
cgctctcatctgcgtgcggccgctgctgctgcagaaggccggtttaaatcacaaattgcg
ccggtgaccatttccggccgacatggcgatgtcacggttgacacggattcggcgattcga
ccggatacatcattagcccagttagcaaaattaccgccagtttttgaagttggcgggacc
gtcacggctggtaatgctagcgggattaatgatggagcggctgcattgattcttatggcg
aagtcaaaagccgagcagttaggcctccactatttggctaccatcaccgactatacagaa
gtcgggattgacccggacatcatggggtatgcgcctaaattagcgattgaccagctaatg
caaaaaaccggacaaactttaacagccattgatcaagtggaattaaatgaagcattcgcc
tcgcaaagtgttgccgtgatgcgtgacctaggactgactgacgaacaggtgaatatcaat
ggcggagcgcttgctttaggccatcccttgggagcatccggcgcgcggattatggtttca
ttgctgtataatttggcggaacgcaggcaacaaaccggtgtcgcggcgttatgtgtcggt
ggtggtatcggtatggcgatgcaagttactttgcatgattag

DBGET integrated database retrieval system