KEGG   Lactobacillus rhamnosus GG: LGG_02276Help
Entry
LGG_02276         CDS       T00987                                 

Gene name
rplL
Definition
(GenBank) LSU/50S ribosomal protein L7/L12P
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
lrh03010  Ribosome
Module
lrh_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:lrh00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    LGG_02276 (rplL)
Ribosome [BR:lrh03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    LGG_02276 (rplL)
  Bacteria
    LGG_02276 (rplL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L12 Ribosomal_L12_N RRF
Motif
Other DBs
NCBI-ProteinID: CAR88171
Position
complement(2345790..2346158)
Genome map
AA seq 122 aa AA seqDB search
MALDVDGIIAQLKDASILELNDLVKSIEDEFGVKAAAPVAAGGAAGGDAAATKDTYDVEL
TEAGQEKVKVIKAVREITGQGLKDAKGLVDAAPKVIKEGLSEDDANKIKEQLEEVGATVT
LK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggctttagatgtagatggcatcattgcacaacttaaagatgcttccattttggaacta
aacgacttagttaagtcgatcgaagatgaattcggtgttaaagcagctgctcctgttgct
gctggcggcgctgctggtggcgatgctgctgctaccaaggatacctatgacgttgaattg
accgaagctggccaagaaaaggttaaggttatcaaggcagttcgtgaaatcactggccaa
ggtctgaaggatgctaagggtctcgttgatgccgctcctaaggttatcaaggaaggcttg
tccgaagacgacgctaacaagatcaaggaacagcttgaagaagtcggcgcaaccgtaact
ttgaaataa

DBGET integrated database retrieval system