KEGG   Leminorella richardii: NCTC12151_00592Help
Entry
NCTC12151_00592   CDS       T05503                                 

Gene name
mdlY
Definition
(GenBank) Mandelamide hydrolase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
lri  Leminorella richardii
Pathway
lri00330  Arginine and proline metabolism
lri00360  Phenylalanine metabolism
lri00380  Tryptophan metabolism
lri00627  Aminobenzoate degradation
lri00643  Styrene degradation
lri01100  Metabolic pathways
lri01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lri00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    NCTC12151_00592 (mdlY)
   00360 Phenylalanine metabolism
    NCTC12151_00592 (mdlY)
   00380 Tryptophan metabolism
    NCTC12151_00592 (mdlY)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    NCTC12151_00592 (mdlY)
   00643 Styrene degradation
    NCTC12151_00592 (mdlY)
Enzymes [BR:lri01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     NCTC12151_00592 (mdlY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: SQI36025
UniProt: A0A2X4X8M0
Position
1:610350..612056
Genome map
AA seq 568 aa AA seqDB search
MIEVTEVSIAELRNALESGRTTAVELVKAYLARVAAYDGPETQTKLNALVVRNPDALKEA
EASDARRARGETLSPLDGIPYTAKDSYLVKGLTAASGSPAFKDLIAYRDAFAIERLRAAG
AICLGKTNMPPMANGGMQRGVYGRAESPYNAKYLTAPFASGSSNGAGTGTAASFSAFGLA
EETWSSGRGPASNNGLCAYTPSRGVISVRGNWPLTPTMDVVVPYARTMADLLEVLDVVVA
DDPDTSGDLWRMQPWVEIPKASEVRPASYRDLAVKADALKGKRFGVPRMFINKDELAGTS
EKPGIGGPTGQRINTRPSVIALWEDARKTLEAAGAEVIEVDFPLISNCEGDRPGAPTVYN
RGMVSKQFLHDELWELSGWAYDKFLRDNGDPKLNRLVDVDGPLIFPHDPGTLPNREDDLG
AGMAEYVNMAKRGLKSWDQIESMPDGLRGVEEIRRVDLEEWMDRQQLDAVLFPTVADVGP
ADADVNPESADIAWSNGIWVANGNLAIRQQGVPTVTVPMGVMADIGMPVGLTFAGRAYDD
SNLLRFAAAFESTGSKRMVPPRTPPLGR
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagttactgaggtttccatcgccgagctgcgcaacgcgctcgagtctggccgc
actacggcggttgaactggtcaaagcctatctcgctcgcgttgctgcttacgacggccca
gaaacgcagacgaaactgaacgcgctggtcgtgcgcaatccggacgcgctcaaagaggcc
gaggcttccgacgcccgtcgcgctcgcggtgagacgcttagcccgctggacggcattccc
tacaccgccaaggacagctatctggtaaaaggccttaccgccgcctcaggcagtccggct
ttcaaggatctgatcgcctatcgcgatgcgttcgccatcgagcgtctgcgcgccgccggc
gctatctgtttaggtaagaccaacatgccgccgatggccaatggcggtatgcagcgcggt
gtttatggtcgtgctgaaagcccgtataacgcaaaatatctcactgcaccgtttgcctcc
ggctcctctaacggagcgggtactggtaccgctgccagcttttccgctttcggtctggct
gaagagacctggtcaagcggtcgcggtccggcgtctaacaacggcctgtgcgcctatacc
ccatcgcgcggtgtgatctcagtgcgcggtaactggccgctgacgccaacaatggatgta
gtagtgccgtatgctcgcactatggctgacctgcttgaagtgctggatgtggtagtcgct
gatgacccagatacaagcggtgacttgtggcgtatgcagccgtgggttgagattccaaag
gcctcggaagtacgtccggcctcctatcgggatctcgctgtcaaggccgacgctcttaag
ggtaaacgcttcggtgtgccacgcatgtttattaataaagatgagctcgcaggcactagc
gagaagcccggcatcggaggcccaacgggccagcgcatcaacacgcgtccgtcagtaatc
gcactctgggaagatgcgcgcaagactctggaagcggcgggagctgaggtgatcgaagtc
gattttccgctgatttccaactgcgaaggcgaccgtcccggtgcgccgaccgtgtacaac
cgaggcatggtgtccaaacagttcctgcatgacgagctgtgggaactctcgggctgggcc
tacgacaagttcctgcgcgataacggcgatccgaagctgaacaggctggttgatgtcgat
gggccgctaatttttccacacgatccgggcactctgccaaaccgtgaagacgatcttggc
gccggcatggccgagtacgtcaatatggccaagcgcgggctgaaaagctgggatcagatc
gagagcatgccggatggcctgcgaggtgtagaagaaattcgccgggtcgatttagaggag
tggatggatcgccagcagctggacgcagtgctgttccctacggtagccgacgttggccca
gccgatgcggacgtgaatccggagtctgctgatattgcctggagtaacggcatttgggtg
gctaacggtaacctggctattcgccaacagggggtacctaccgttaccgtaccaatggga
gtgatggctgatatcggcatgccggtggggctgacctttgccggtcgtgcgtatgacgac
agcaatctgttgcgctttgccgccgcctttgagtctaccggttcgaagcgcatggtgccg
ccgcgcacgccgccgcttggacgataa

DBGET integrated database retrieval system